Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01016
Gene name
Locationscaffold_01:3817045..3819079
Strand+
Gene length (bp)2034
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 3.4E-44 253 522

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 55 74 19
2 162 184 22
3 196 218 22
4 311 333 22
5 354 373 19
6 383 405 22
7 473 495 22
8 499 521 22
9 534 556 22
10 576 594 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01016
MDTVRYLGKVYEPDTLDTRFTTSSSVPYETVVDGRRRERDGKASASAKQLLTPEFCLYYLIIWTVVPWMFWIAYD
VSRPSDPRYAKYERYLSPGWIPGRKVDVSDSQYHTFRQNVPFMAGFLVCHPLLRLAWNAFYRKPGTSSLASGGTP
RLLERVSFDYYFAILFLVILHGVSALKVLAILHINYRIAKGLPRRFVPAATWVFNIGILFANDIYQGYHLKPMAA
RFAPGDSNLVRWAGWLDGHGGLMARWEVLFNISVLRLISFNMDYYWSFDGRHAESLEKQLDRASLSEKERISTGA
EPGDYSFRNYVAYAVYAPLYLAGPILTFNDYVAQSRHRAASIESARTLRYGLRLLLALLAMEVVLHIDYVGAIAK
ASPDWGSYTPAQLSLLSLFNLHVIWLKLLLPWRLFRLWALVDGIDPPENMVRCVSNNYSTQLFWRAWHRSYNRWL
IRYLYGPLIGYPMAVKGGGGRWRSLARAVLTYLTVFTFVALWHDIQMRLLIWGWLIVVFMLPEWTAVWLFPRRQW
ESRPVAYRLLCGVGGVMNVLLMMSANLVGFAVGLDGLQSIIRGIFRDWSGFVFLFTACSCLFVGVQVMFRLRESE
RKRGVTLRC*
Coding >Ophcf2|01016
ATGGACACGGTCCGCTACCTCGGAAAGGTCTACGAACCGGACACGCTCGACACTCGCTTCACGACTTCGTCTTCG
GTCCCGTACGAGACTGTCGTCGATGGCCGTCGTCGAGAGCGCGATGGCAAGGCGTCGGCGTCGGCTAAGCAATTA
CTGACGCCCGAGTTTTGCCTGTATTATCTCATCATTTGGACGGTTGTGCCTTGGATGTTCTGGATCGCCTATGAT
GTCTCTAGGCCTTCCGATCCCCGGTATGCCAAGTACGAGCGCTATCTATCTCCCGGATGGATCCCCGGACGCAAG
GTCGACGTCTCGGACTCTCAATATCACACCTTTCGGCAGAACGTGCCCTTCATGGCTGGCTTCCTCGTCTGCCAT
CCGCTGCTGAGGCTGGCCTGGAACGCCTTTTACCGGAAACCCGGAACGTCTTCGCTTGCTTCGGGCGGTACGCCG
CGGCTGCTAGAGCGCGTCTCGTTTGATTACTACTTTGCCATCCTGTTCCTCGTCATTCTGCACGGCGTTTCGGCC
CTCAAGGTGCTGGCCATTCTGCACATCAACTACCGCATCGCAAAGGGCCTGCCTAGGCGCTTCGTGCCGGCCGCT
ACTTGGGTCTTCAACATCGGCATTCTCTTCGCCAACGACATCTACCAGGGGTATCATCTCAAGCCCATGGCCGCC
CGGTTCGCGCCGGGCGACTCGAATCTCGTCCGCTGGGCTGGCTGGCTCGACGGCCACGGTGGGCTCATGGCCCGG
TGGGAGGTGCTGTTCAACATCAGCGTCTTGCGTCTCATAAGCTTCAACATGGACTACTACTGGAGCTTCGACGGC
CGCCACGCCGAATCCCTCGAGAAGCAGCTGGACCGGGCCAGCCTGTCGGAAAAGGAGCGCATCTCGACCGGGGCC
GAGCCCGGCGACTATAGCTTCCGCAACTACGTCGCCTACGCCGTCTACGCGCCCCTATACCTGGCCGGGCCGATC
CTGACTTTCAACGACTACGTGGCCCAGTCGAGGCATCGGGCGGCCAGCATCGAGTCGGCTCGCACGCTGCGGTAC
GGCCTGCGTCTCCTACTGGCCCTGCTGGCCATGGAGGTGGTGCTTCATATCGACTACGTGGGAGCCATCGCAAAG
GCCAGCCCGGACTGGGGCAGCTACACGCCCGCGCAGCTGAGCCTACTATCACTCTTCAACCTGCACGTCATCTGG
CTCAAGCTGCTGCTGCCATGGCGCCTCTTCCGCCTCTGGGCCCTCGTCGACGGCATCGACCCGCCCGAGAACATG
GTGCGGTGCGTCAGCAACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAACCGCTGGCTG
ATCCGCTACCTGTACGGGCCCCTCATCGGCTACCCCATGGCCGTCAAGGGGGGAGGAGGACGGTGGCGCTCGCTG
GCCCGCGCTGTCCTGACCTACCTGACCGTCTTCACCTTTGTCGCCCTCTGGCACGATATCCAGATGCGACTGCTC
ATCTGGGGCTGGCTGATTGTCGTCTTTATGCTACCCGAGTGGACGGCCGTGTGGCTGTTTCCACGCCGGCAGTGG
GAGTCGCGTCCGGTGGCCTATCGTCTTTTGTGCGGCGTCGGGGGCGTCATGAACGTGCTTCTCATGATGTCGGCC
AACCTCGTCGGCTTTGCTGTTGGGCTGGACGGGCTGCAGAGTATCATCCGCGGGATATTCCGTGATTGGTCTGGC
TTCGTCTTCCTCTTCACCGCTTGCTCGTGCCTCTTCGTCGGGGTGCAGGTCATGTTCCGGTTGCGCGAGTCGGAG
AGGAAAAGGGGCGTGACGCTCAGGTGCTGA
Transcript >Ophcf2|01016
ATGGACACGGTCCGCTACCTCGGAAAGGTCTACGAACCGGACACGCTCGACACTCGCTTCACGACTTCGTCTTCG
GTCCCGTACGAGACTGTCGTCGATGGCCGTCGTCGAGAGCGCGATGGCAAGGCGTCGGCGTCGGCTAAGCAATTA
CTGACGCCCGAGTTTTGCCTGTATTATCTCATCATTTGGACGGTTGTGCCTTGGATGTTCTGGATCGCCTATGAT
GTCTCTAGGCCTTCCGATCCCCGGTATGCCAAGTACGAGCGCTATCTATCTCCCGGATGGATCCCCGGACGCAAG
GTCGACGTCTCGGACTCTCAATATCACACCTTTCGGCAGAACGTGCCCTTCATGGCTGGCTTCCTCGTCTGCCAT
CCGCTGCTGAGGCTGGCCTGGAACGCCTTTTACCGGAAACCCGGAACGTCTTCGCTTGCTTCGGGCGGTACGCCG
CGGCTGCTAGAGCGCGTCTCGTTTGATTACTACTTTGCCATCCTGTTCCTCGTCATTCTGCACGGCGTTTCGGCC
CTCAAGGTGCTGGCCATTCTGCACATCAACTACCGCATCGCAAAGGGCCTGCCTAGGCGCTTCGTGCCGGCCGCT
ACTTGGGTCTTCAACATCGGCATTCTCTTCGCCAACGACATCTACCAGGGGTATCATCTCAAGCCCATGGCCGCC
CGGTTCGCGCCGGGCGACTCGAATCTCGTCCGCTGGGCTGGCTGGCTCGACGGCCACGGTGGGCTCATGGCCCGG
TGGGAGGTGCTGTTCAACATCAGCGTCTTGCGTCTCATAAGCTTCAACATGGACTACTACTGGAGCTTCGACGGC
CGCCACGCCGAATCCCTCGAGAAGCAGCTGGACCGGGCCAGCCTGTCGGAAAAGGAGCGCATCTCGACCGGGGCC
GAGCCCGGCGACTATAGCTTCCGCAACTACGTCGCCTACGCCGTCTACGCGCCCCTATACCTGGCCGGGCCGATC
CTGACTTTCAACGACTACGTGGCCCAGTCGAGGCATCGGGCGGCCAGCATCGAGTCGGCTCGCACGCTGCGGTAC
GGCCTGCGTCTCCTACTGGCCCTGCTGGCCATGGAGGTGGTGCTTCATATCGACTACGTGGGAGCCATCGCAAAG
GCCAGCCCGGACTGGGGCAGCTACACGCCCGCGCAGCTGAGCCTACTATCACTCTTCAACCTGCACGTCATCTGG
CTCAAGCTGCTGCTGCCATGGCGCCTCTTCCGCCTCTGGGCCCTCGTCGACGGCATCGACCCGCCCGAGAACATG
GTGCGGTGCGTCAGCAACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAACCGCTGGCTG
ATCCGCTACCTGTACGGGCCCCTCATCGGCTACCCCATGGCCGTCAAGGGGGGAGGAGGACGGTGGCGCTCGCTG
GCCCGCGCTGTCCTGACCTACCTGACCGTCTTCACCTTTGTCGCCCTCTGGCACGATATCCAGATGCGACTGCTC
ATCTGGGGCTGGCTGATTGTCGTCTTTATGCTACCCGAGTGGACGGCCGTGTGGCTGTTTCCACGCCGGCAGTGG
GAGTCGCGTCCGGTGGCCTATCGTCTTTTGTGCGGCGTCGGGGGCGTCATGAACGTGCTTCTCATGATGTCGGCC
AACCTCGTCGGCTTTGCTGTTGGGCTGGACGGGCTGCAGAGTATCATCCGCGGGATATTCCGTGATTGGTCTGGC
TTCGTCTTCCTCTTCACCGCTTGCTCGTGCCTCTTCGTCGGGGTGCAGGTCATGTTCCGGTTGCGCGAGTCGGAG
AGGAAAAGGGGCGTGACGCTCAGGTGCTGA
Gene >Ophcf2|01016
ATGGACACGGTCCGCTACCTCGGAAAGGTCTACGAACCGGACACGCTCGACACTCGCTTCACGACTTCGTCTTCG
GTCCCGTACGAGACTGTCGTCGATGGCCGTCGTCGAGAGCGCGATGGCAAGGCGTCGGCGTCGGCTAAGCAATTA
CTGACGCCCGAGTTTTGCCTGTATTATCTCATCATTTGGACGGTTGTGCCTTGGATGTTCTGGATCGCCTATGAT
GTCTCTAGGCGTTGGTCTCTTCCTTCCTCCCTCTCTCTCTCTCTCCGTCTCTCGTCATGGTCTGGCTGACGTCCC
GATAGCTTCCGATCCCCGGTATGCCAAGTACGAGCGCTATCTATCTCCCGGATGGATCCCCGGACGCAAGGTCGA
CGTCTCGGACTCTCAATATCACACCTTTCGGCAGAACGTGCCCTTCATGGCTGGCTTCCTCGTCTGCCATCCGCT
GCTGAGGCTGGCCTGGAACGCCTTTTACCGGAAACCCGGAACGTCTTCGCTTGCTTCGGGCGGTACGCCGCGGCT
GCTAGAGCGCGTCTCGTTTGATTACTACTTTGCCATCCTGTTCCTCGTCATTCTGCACGGCGTTTCGGCCCTCAA
GGTGCTGGCCATTCTGCACATCAACTACCGCATCGCAAAGGGCCTGCCTAGGCGCTTCGTGCCGGCCGCTACTTG
GGTCTTCAACATCGGCATTCTCTTCGCCAACGACATCTACCAGGGGTATCATCTCAAGCCCATGGCCGCCCGGTT
CGCGCCGGGCGACTCGAATCTCGTCCGCTGGGCTGGCTGGCTCGACGGCCACGGTGGGCTCATGGCCCGGTGGGA
GGTGCTGTTCAACATCAGCGTCTTGCGTCTCATAAGCTTCAACATGGACTACTACTGGAGCTTCGACGGCCGCCA
CGCCGAATCCCTCGAGGTACGCTCCGCCAAGCCCTCTACCCCTTTCGCCTCTTCCGGCGCCCCGGCTCAAAGTCG
CAAAAAGAAGCAGCTGGACCGGGCCAGCCTGTCGGAAAAGGAGCGCATCTCGACCGGGGCCGAGCCCGGCGACTA
TAGCTTCCGCAACTACGTCGCCTACGCCGTCTACGCGCCCCTATACCTGGCCGGGCCGATCCTGACTTTCAACGA
CTACGTGGCCCAGTCGAGGCATCGGGCGGCCAGCATCGAGTCGGCTCGCACGCTGCGGTACGGCCTGCGTCTCCT
ACTGGCCCTGCTGGCCATGGAGGTGGTGCTTCATATCGACTACGTGGGAGCCATCGCAAAGGCCAGCCCGGACTG
GGGCAGCTACACGCCCGCGCAGCTGAGCCTACTATCACTCTTCAACCTGCACGTCATCTGGCTCAAGCTGCTGCT
GCCATGGCGCCTCTTCCGCCTCTGGGCCCTCGTCGACGGCATCGACCCGCCCGAGAACATGGTGCGGTGCGTCAG
CAACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAACCGCTGGCTGATCCGCTACCTGTA
CGGGCCCCTCATCGGCTACCCCATGGCCGTCAAGGGGGGAGGAGGACGGTGGCGCTCGCTGGCCCGCGCTGTCCT
GACCTACCTGACCGTCTTCACCTTTGTCGCCCTCTGGCACGATATCCAGATGCGACTGCTCATCTGGGGCTGGCT
GATTGTCGTCTTTATGCTACCCGAGTGGACGGCCGTGTGGCTGTTTCCACGCCGGCAGTGGGAGTCGCGTCCGGT
GGCCTATCGTCTTTTGTGCGGCGTCGGGGGCGTCATGAACGTGCTTCTCATGATGTCGGCCAACCTCGTCGGCTT
TGCTGTTGGGCTGGACGGGCTGCAGAGTATCATCCGCGGGATATTCCGTGATTGGTCTGGTGAGGACGACATCTA
TTTACTACCCTCGGTCCCAGGTTGAAGAAAGACCGTTTGCTAACTTTGGCAGGCTTCGTCTTCCTCTTCACCGCT
TGCTCGTGCCTCTTCGTCGGGGTGCAGGTCATGTTCCGGTTGCGCGAGTCGGAGAGGAAAAGGGGCGTGACGCTC
AGGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail