Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01010
Gene name
Locationscaffold_01:3804494..3805830
Strand+
Gene length (bp)1336
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 73 92 19
3 112 134 22
4 155 177 22
5 199 221 22
6 242 261 19
7 281 303 22
8 310 329 19
9 333 355 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 124.83 70.98 178.68
Alive In ants, during behavior modification 170.72 93.70 247.74
Dead In ants, recently dead 182.54 100.15 264.93

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.106626 no
Alive Dead 0.747866 no
Dead Fungus 0.045713 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01010
MSDKKSDDFVVRVPEISLSRADEKLPLAADGRSMSMLSSVESSGGISVAAYCLSSISMTLVNKYVVSGNQWNLHL
LYLAIQSVVGTVTILVCKQAGLIKDLDPFDTRRAKKWFPISLLLVGMIFTGNKALQFLSVPVYTIFKNLTIIVIA
YGEMLWFGGSVSPLSLVSFVLMVSSSMLAAWADFHSVRTDSSGAAHRAATAAATATLSTGYAWMGLNVMCSALYV
LSMRKAIKITNLKNWDVMFYNNLLTIPVLVLSSLMIEDWSGANLARNFPPATRQNLMVGMVYSGLAAIFISYCTA
WCIRATSSTTYAMAGALNKLPMAVAGLVFFSDPVTFGSVSAIFLGFVSGLIYTWAKNRKSRQAGLPTAVSRAASG
TLSPHEKAEAAKD*
Coding >Ophcf2|01010
ATGTCGGATAAGAAGAGCGACGATTTCGTCGTTCGCGTGCCGGAAATCAGCCTTTCGCGCGCCGACGAGAAGCTG
CCGCTGGCTGCCGATGGCCGGTCCATGTCGATGCTTTCGTCGGTTGAGAGCAGCGGCGGCATCTCCGTCGCTGCC
TACTGCCTGTCGTCCATCAGCATGACGCTCGTCAACAAGTACGTCGTGTCGGGGAACCAGTGGAATCTGCATCTG
CTGTACCTGGCCATCCAGTCTGTCGTTGGTACTGTCACTATCCTCGTCTGCAAGCAGGCCGGCCTCATCAAGGAT
CTCGACCCCTTTGACACGAGGAGAGCCAAAAAGTGGTTCCCCATCTCGCTGCTGCTAGTCGGCATGATCTTCACG
GGCAACAAGGCGCTGCAGTTTCTGTCAGTGCCCGTCTACACCATCTTCAAGAACCTGACCATCATCGTCATCGCA
TACGGGGAGATGCTGTGGTTCGGCGGCAGCGTCAGCCCGCTGAGCCTCGTCTCCTTTGTGTTGATGGTCTCGAGC
TCGATGCTGGCGGCCTGGGCCGACTTTCACAGCGTCCGGACCGATTCTTCGGGCGCTGCTCACAGGGCCGCCACT
GCCGCCGCCACGGCGACGCTGAGCACGGGCTACGCCTGGATGGGCCTCAACGTCATGTGCTCGGCGCTGTACGTT
CTGAGTATGCGCAAGGCCATCAAGATAACCAACCTCAAGAACTGGGACGTCATGTTCTACAACAACCTGCTGACC
ATTCCGGTCCTGGTCCTCTCGTCTCTCATGATAGAGGACTGGTCCGGCGCCAACCTGGCGCGCAACTTCCCCCCG
GCGACGCGCCAGAACCTGATGGTCGGCATGGTCTACTCGGGCCTGGCTGCCATCTTCATCTCGTACTGCACGGCC
TGGTGCATCCGCGCCACATCGTCGACGACGTACGCCATGGCCGGCGCCCTCAACAAGCTGCCCATGGCCGTCGCC
GGCCTCGTCTTCTTCTCCGACCCCGTCACGTTCGGCAGCGTGTCGGCCATCTTCCTCGGCTTCGTCAGCGGTCTC
ATCTACACGTGGGCCAAGAACAGAAAGTCGCGACAGGCCGGTCTGCCGACGGCCGTCAGCCGCGCGGCGTCGGGG
ACGCTGTCGCCGCATGAAAAGGCCGAGGCAGCCAAGGACTGA
Transcript >Ophcf2|01010
ATGTCGGATAAGAAGAGCGACGATTTCGTCGTTCGCGTGCCGGAAATCAGCCTTTCGCGCGCCGACGAGAAGCTG
CCGCTGGCTGCCGATGGCCGGTCCATGTCGATGCTTTCGTCGGTTGAGAGCAGCGGCGGCATCTCCGTCGCTGCC
TACTGCCTGTCGTCCATCAGCATGACGCTCGTCAACAAGTACGTCGTGTCGGGGAACCAGTGGAATCTGCATCTG
CTGTACCTGGCCATCCAGTCTGTCGTTGGTACTGTCACTATCCTCGTCTGCAAGCAGGCCGGCCTCATCAAGGAT
CTCGACCCCTTTGACACGAGGAGAGCCAAAAAGTGGTTCCCCATCTCGCTGCTGCTAGTCGGCATGATCTTCACG
GGCAACAAGGCGCTGCAGTTTCTGTCAGTGCCCGTCTACACCATCTTCAAGAACCTGACCATCATCGTCATCGCA
TACGGGGAGATGCTGTGGTTCGGCGGCAGCGTCAGCCCGCTGAGCCTCGTCTCCTTTGTGTTGATGGTCTCGAGC
TCGATGCTGGCGGCCTGGGCCGACTTTCACAGCGTCCGGACCGATTCTTCGGGCGCTGCTCACAGGGCCGCCACT
GCCGCCGCCACGGCGACGCTGAGCACGGGCTACGCCTGGATGGGCCTCAACGTCATGTGCTCGGCGCTGTACGTT
CTGAGTATGCGCAAGGCCATCAAGATAACCAACCTCAAGAACTGGGACGTCATGTTCTACAACAACCTGCTGACC
ATTCCGGTCCTGGTCCTCTCGTCTCTCATGATAGAGGACTGGTCCGGCGCCAACCTGGCGCGCAACTTCCCCCCG
GCGACGCGCCAGAACCTGATGGTCGGCATGGTCTACTCGGGCCTGGCTGCCATCTTCATCTCGTACTGCACGGCC
TGGTGCATCCGCGCCACATCGTCGACGACGTACGCCATGGCCGGCGCCCTCAACAAGCTGCCCATGGCCGTCGCC
GGCCTCGTCTTCTTCTCCGACCCCGTCACGTTCGGCAGCGTGTCGGCCATCTTCCTCGGCTTCGTCAGCGGTCTC
ATCTACACGTGGGCCAAGAACAGAAAGTCGCGACAGGCCGGTCTGCCGACGGCCGTCAGCCGCGCGGCGTCGGGG
ACGCTGTCGCCGCATGAAAAGGCCGAGGCAGCCAAGGACTGA
Gene >Ophcf2|01010
ATGTCGGATAAGAAGAGCGACGATTTCGTCGTTCGCGTGCCGGAAATCAGCCTTTCGCGCGCCGACGAGAAGCTG
CCGCTGGCTGCCGATGGCCGGTCCATGTCGATGCTTTCGTCGGTTGAGAGCAGCGGCGGCATCTCCGTCGCTGCC
TACTGCCTGTCGTCCATCAGCATGACGCTCGTCAACAAGTACGTCGTGTCGGGGAACCAGTGGAATCTGCATCTG
CTGTACCTGGCCATCCAGGTGAGTTGTCCGGCTCCCATCGCTGGCCCACGCTGGCTAACGCCTTGCGCTTTTCAG
TCTGTCGTTGGTACTGTCACTATCCTCGTCTGCAAGCAGGCCGGCCTCATCAAGGATCTCGACCCCTTTGACACG
AGGAGAGCCAAAAAGTGTAGGCATCAATGATTCGCCCTTTTCGATCCCTCGATCCCCCGCTGACCCGGAACGCAG
GGTTCCCCATCTCGCTGCTGCTAGTCGGCATGATCTTCACGGGCAACAAGGCGCTGCAGTTTCTGTCAGTGCCCG
TCTACACCATCTTCAAGAACCTGACCATCATCGTCATCGCATACGGGGAGATGCTGTGGTTCGGCGGCAGCGTCA
GCCCGCTGAGCCTCGTCTCCTTTGTGTTGATGGTCTCGAGCTCGATGCTGGCGGCCTGGGCCGACTTTCACAGCG
TCCGGACCGATTCTTCGGGCGCTGCTCACAGGGCCGCCACTGCCGCCGCCACGGCGACGCTGAGCACGGGCTACG
CCTGGATGGGCCTCAACGTCATGTGCTCGGCGCTGTACGTTCTGAGTATGCGCAAGGCCATCAAGATAACCAACC
TCAAGAACTGGGACGGTAAGCCGGGCCCGCCCTGGTGGACGGCTGCGCGCTGACGACGGAGAATATAGTCATGTT
CTACAACAACCTGCTGACCATTCCGGTCCTGGTCCTCTCGTCTCTCATGATAGAGGACTGGTCCGGCGCCAACCT
GGCGCGCAACTTCCCCCCGGCGACGCGCCAGAACCTGATGGTCGGCATGGTCTACTCGGGCCTGGCTGCCATCTT
CATCTCGTACTGCACGGCCTGGTGCATCCGCGCCACATCGTCGACGACGTACGCCATGGCCGGCGCCCTCAACAA
GCTGCCCATGGCCGTCGCCGGCCTCGTCTTCTTCTCCGACCCCGTCACGTTCGGCAGCGTGTCGGCCATCTTCCT
CGGCTTCGTCAGCGGTCTCATCTACACGTGGGCCAAGAACAGAAAGTCGCGACAGGCCGGTCTGCCGACGGCCGT
CAGCCGCGCGGCGTCGGGGACGCTGTCGCCGCATGAAAAGGCCGAGGCAGCCAAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail