Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01009
Gene name
Locationscaffold_01:3802461..3803249
Strand-
Gene length (bp)788
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.3E-25 9 102

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5258 0.4443 0.05 0.128 0.2515 0.0701 0.3374 0.2227 0.2475 0.0357

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5120
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6589
Ophiocordyceps australis map64 (Brazil) OphauB2|1498
Ophiocordyceps camponoti-floridani Ophcf2|01009 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2321
Ophiocordyceps kimflemingae Ophio5|7934
Ophiocordyceps subramaniannii Hirsu2|3376

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01009
MSGPVSIGSTTEWQSLLSKTSVVVADFYADWCGPCKMVAPHFERLAAQHSRPGKVAFAKVNVDNQSAIARAQGVS
AMPTFKIFHRGQCIDTVKGANMPALTDVVTKALRLADSGPSGDVFKTPGRTLGGTTPARTSIGGRGFSRSWDTAT
LFQSLYLFLGLYLVSLFSFDARKAAEDSPFNIHKNPPSQRANPSRPTNKASARPQQKSSFKTLADLGSE*
Coding >Ophcf2|01009
ATGAGCGGTCCGGTAAGCATAGGATCCACGACGGAGTGGCAGTCGCTGCTCTCCAAGACCAGCGTCGTCGTTGCA
GACTTCTACGCCGACTGGTGTGGCCCCTGCAAGATGGTGGCACCGCACTTCGAGCGGCTCGCAGCTCAGCACTCG
CGCCCGGGAAAGGTGGCCTTTGCCAAGGTCAACGTCGACAACCAGTCGGCCATTGCCCGCGCCCAGGGCGTCTCA
GCCATGCCGACCTTCAAGATATTTCACCGCGGCCAGTGCATCGATACGGTAAAGGGCGCCAACATGCCCGCCCTC
ACCGACGTGGTAACAAAGGCGCTCCGGCTGGCTGATTCCGGCCCCTCCGGTGACGTGTTTAAGACACCGGGCCGT
ACGCTGGGCGGCACGACCCCTGCGCGGACGTCGATTGGCGGCCGCGGTTTCTCCCGTTCCTGGGACACGGCTACC
CTTTTCCAGTCTCTATATCTTTTCCTGGGGCTGTACTTGGTCTCGCTCTTCTCGTTTGACGCCCGCAAGGCGGCA
GAGGACTCGCCGTTCAATATCCACAAGAACCCCCCTTCGCAGCGCGCCAACCCATCGCGTCCGACGAACAAGGCG
TCCGCCCGCCCGCAGCAAAAGTCTAGCTTCAAAACACTGGCAGACCTGGGCTCGGAATGA
Transcript >Ophcf2|01009
ATGAGCGGTCCGGTAAGCATAGGATCCACGACGGAGTGGCAGTCGCTGCTCTCCAAGACCAGCGTCGTCGTTGCA
GACTTCTACGCCGACTGGTGTGGCCCCTGCAAGATGGTGGCACCGCACTTCGAGCGGCTCGCAGCTCAGCACTCG
CGCCCGGGAAAGGTGGCCTTTGCCAAGGTCAACGTCGACAACCAGTCGGCCATTGCCCGCGCCCAGGGCGTCTCA
GCCATGCCGACCTTCAAGATATTTCACCGCGGCCAGTGCATCGATACGGTAAAGGGCGCCAACATGCCCGCCCTC
ACCGACGTGGTAACAAAGGCGCTCCGGCTGGCTGATTCCGGCCCCTCCGGTGACGTGTTTAAGACACCGGGCCGT
ACGCTGGGCGGCACGACCCCTGCGCGGACGTCGATTGGCGGCCGCGGTTTCTCCCGTTCCTGGGACACGGCTACC
CTTTTCCAGTCTCTATATCTTTTCCTGGGGCTGTACTTGGTCTCGCTCTTCTCGTTTGACGCCCGCAAGGCGGCA
GAGGACTCGCCGTTCAATATCCACAAGAACCCCCCTTCGCAGCGCGCCAACCCATCGCGTCCGACGAACAAGGCG
TCCGCCCGCCCGCAGCAAAAGTCTAGCTTCAAAACACTGGCAGACCTGGGCTCGGAATGA
Gene >Ophcf2|01009
ATGAGCGGTCCGGTAAGCATAGGATCCACGACGGAGTGGCAGTCGCTGCTCTCCAAGACCAGCGTCGTCGTTGCA
GACTGTGTGTCCTCTCTCACCCATCTCCTACACAGTTTACTACTCAAGTCTGCGGACCGGCTGACAAGAATGTCT
CTTCAGTCTACGCCGACTGGTGTGGCCCCTGCAAGATGGTGGCACCGCACTTCGAGCGGCTCGCAGCTCAGCACT
CGCGCCCGGGAAAGGTGGCCTTTGCCAAGGTCAACGTCGACAACCAGTCGGCCATTGCCCGCGCCCAGGGCGTCT
CAGCCATGCCGACCTTCAAGATATTTCACCGCGGCCAGTGCATCGATACGGTAAAGGGCGCCAACATGCCCGCCC
TCACCGACGTGGTAACAAAGGCGCTCCGGCTGGCTGATTCCGGCCCCTCCGGTGACGTGTTTAAGACACCGGGCC
GTACGCTGGGCGGCACGACCCCTGCGCGGACGTCGATTGGCGGCCGCGGTTTCTCCCGTTCCTGGGACACGGCTA
CCCTTTTCCAGTCTCTATATCTTTTCCTGGGGCTGTACTTGGTCTCGCTCTTCTCGGTGCGTCAGAGTGAAGACA
TGCTGGGGTCTGTGCTGACTGCGAGGCCGCAGTTTGACGCCCGCAAGGCGGCAGAGGACTCGCCGTTCAATATCC
ACAAGAACCCCCCTTCGCAGCGCGCCAACCCATCGCGTCCGACGAACAAGGCGTCCGCCCGCCCGCAGCAAAAGT
CTAGCTTCAAAACACTGGCAGACCTGGGCTCGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail