Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01007
Gene name
Locationscaffold_01:3797818..3799061
Strand+
Gene length (bp)1243
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1492 0.0448 0.9015 0.0946 0.1304 0.0225 0.3394 0.4639 0.1523 0.0126

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999794

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup98
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3581
Ophiocordyceps australis map64 (Brazil) OphauB2|324
Ophiocordyceps camponoti-floridani Ophcf2|01007 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7143
Ophiocordyceps kimflemingae Ophio5|7930
Ophiocordyceps subramaniannii Hirsu2|156
Ophiocordyceps subramaniannii Hirsu2|2137
Ophiocordyceps subramaniannii Hirsu2|3139
Ophiocordyceps subramaniannii Hirsu2|3419
Ophiocordyceps subramaniannii Hirsu2|5164
Ophiocordyceps subramaniannii Hirsu2|7455
Ophiocordyceps subramaniannii Hirsu2|9490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01007
MTRLLSLLLLASPLLALSNKVQTSDCNDFGAHCNITPGDRIVDGYRLYPENASFDSKTCLVYFSSLWNNTIAIYD
AVHNKIVGSIDYPFGGRQDLHANAVLVDSCNRELTAGFTSAYPWDTQGARVDGPNFIAQYDLDTHELLWTVDLSK
PTNYRYGGFQDVAQDRYGNLFVAGTYPAALVRIDAKTRAVEPWYLSSANSTTAGYSGLAMFEFRKLLVSDQSAET
GSNLVSFDVDVKRPSRPRPIPVTWASNGTLTGISIEPDAIVLAPKYRGKVLLVADNSLGTVVLYSDDGWVTAKKL
GVVPSLFFGTTANPGDAEGQVVVSLQIGQRLFAVYEFFPDGVYLFPGAHKTAGERTCFPLQDITDDVERLVQQYV
NRGRTIGRGRPTYHY*
Coding >Ophcf2|01007
ATGACCCGTCTGCTGTCCCTCCTCCTGCTGGCCTCTCCGTTGCTGGCCTTGTCGAACAAAGTGCAGACTTCGGAT
TGCAACGACTTTGGAGCCCATTGCAACATTACCCCGGGCGACAGAATCGTCGACGGCTACAGGCTCTATCCTGAG
AATGCCAGCTTCGACTCTAAGACATGTCTGGTGTATTTCAGCTCTCTTTGGAACAACACCATCGCCATCTATGAC
GCTGTACACAACAAGATTGTCGGGTCCATCGACTACCCCTTCGGAGGACGGCAAGACCTTCACGCCAATGCCGTC
CTGGTCGACTCGTGCAATAGAGAGTTGACAGCCGGCTTCACATCGGCCTATCCGTGGGATACCCAAGGAGCCAGG
GTCGACGGGCCCAACTTCATCGCCCAATATGATCTCGATACTCACGAGTTGCTCTGGACCGTCGATCTCTCCAAG
CCGACCAACTACCGGTACGGAGGCTTCCAGGACGTGGCGCAAGACAGATACGGCAACCTGTTTGTCGCTGGGACT
TACCCGGCCGCTCTGGTGCGGATAGATGCCAAAACCCGGGCAGTCGAGCCTTGGTATCTGTCATCGGCCAATTCG
ACTACCGCGGGATACTCAGGTCTAGCCATGTTCGAGTTCCGAAAGCTCCTGGTCTCGGACCAGTCAGCCGAGACG
GGGAGCAACCTCGTCTCCTTCGACGTCGACGTCAAGAGACCATCGCGTCCGAGGCCGATACCGGTGACTTGGGCT
TCGAACGGAACTCTGACGGGCATATCGATTGAGCCCGATGCCATCGTGCTGGCCCCCAAGTATCGGGGCAAGGTT
CTCCTGGTTGCAGACAACTCCCTCGGCACCGTCGTTCTGTACTCGGACGATGGCTGGGTGACAGCCAAGAAGCTC
GGAGTCGTCCCGAGTCTGTTCTTCGGGACTACGGCGAACCCTGGCGATGCCGAGGGCCAAGTTGTTGTTTCGCTT
CAGATCGGACAGCGCCTTTTCGCAGTGTACGAGTTCTTTCCCGATGGTGTTTACCTGTTCCCCGGGGCTCATAAG
ACGGCCGGTGAGAGGACATGCTTCCCGTTGCAAGATATCACGGACGACGTGGAGAGGCTAGTGCAACAATATGTC
AATAGGGGCAGGACCATTGGCCGGGGGAGACCGACGTATCATTACTGA
Transcript >Ophcf2|01007
ATGACCCGTCTGCTGTCCCTCCTCCTGCTGGCCTCTCCGTTGCTGGCCTTGTCGAACAAAGTGCAGACTTCGGAT
TGCAACGACTTTGGAGCCCATTGCAACATTACCCCGGGCGACAGAATCGTCGACGGCTACAGGCTCTATCCTGAG
AATGCCAGCTTCGACTCTAAGACATGTCTGGTGTATTTCAGCTCTCTTTGGAACAACACCATCGCCATCTATGAC
GCTGTACACAACAAGATTGTCGGGTCCATCGACTACCCCTTCGGAGGACGGCAAGACCTTCACGCCAATGCCGTC
CTGGTCGACTCGTGCAATAGAGAGTTGACAGCCGGCTTCACATCGGCCTATCCGTGGGATACCCAAGGAGCCAGG
GTCGACGGGCCCAACTTCATCGCCCAATATGATCTCGATACTCACGAGTTGCTCTGGACCGTCGATCTCTCCAAG
CCGACCAACTACCGGTACGGAGGCTTCCAGGACGTGGCGCAAGACAGATACGGCAACCTGTTTGTCGCTGGGACT
TACCCGGCCGCTCTGGTGCGGATAGATGCCAAAACCCGGGCAGTCGAGCCTTGGTATCTGTCATCGGCCAATTCG
ACTACCGCGGGATACTCAGGTCTAGCCATGTTCGAGTTCCGAAAGCTCCTGGTCTCGGACCAGTCAGCCGAGACG
GGGAGCAACCTCGTCTCCTTCGACGTCGACGTCAAGAGACCATCGCGTCCGAGGCCGATACCGGTGACTTGGGCT
TCGAACGGAACTCTGACGGGCATATCGATTGAGCCCGATGCCATCGTGCTGGCCCCCAAGTATCGGGGCAAGGTT
CTCCTGGTTGCAGACAACTCCCTCGGCACCGTCGTTCTGTACTCGGACGATGGCTGGGTGACAGCCAAGAAGCTC
GGAGTCGTCCCGAGTCTGTTCTTCGGGACTACGGCGAACCCTGGCGATGCCGAGGGCCAAGTTGTTGTTTCGCTT
CAGATCGGACAGCGCCTTTTCGCAGTGTACGAGTTCTTTCCCGATGGTGTTTACCTGTTCCCCGGGGCTCATAAG
ACGGCCGGTGAGAGGACATGCTTCCCGTTGCAAGATATCACGGACGACGTGGAGAGGCTAGTGCAACAATATGTC
AATAGGGGCAGGACCATTGGCCGGGGGAGACCGACGTATCATTACTGA
Gene >Ophcf2|01007
ATGACCCGTCTGCTGTCCCTCCTCCTGCTGGCCTCTCCGTTGCTGGCCTTGTCGAACAAAGTGCAGACTTCGGAT
TGCAACGACTTTGGAGCCCATTGCAACATTACCCCGGGCGACAGAATCGTCGACGGCTACAGGCTCTATCCTGAG
AATGCCAGCTTCGACTCTAAGACATGTCTGGTGTATTTCAGGTAACATGGATGACGGCATCAATGGTGCTTACAT
TGTACATGTGAGGCTGACGGTAATACCCACGAATAGCTCTCTTTGGAACAACACCATCGCCATCTATGACGCTGT
ACACAACAAGATTGTCGGGTCCATCGACTACCCCTTCGGAGGACGGCAAGACCTTCACGCCAATGCCGTCCTGGT
CGACTCGTGCAATAGAGAGTTGACAGCCGGCTTCACATCGGCCTATCCGTGGGATACCCAAGGAGCCAGGGTCGA
CGGGCCCAACTTCATCGCCCAATATGATCTCGATACTCACGAGTTGCTCTGGACCGTCGATCTCTCCAAGCCGAC
CAACTACCGGTACGGAGGCTTCCAGGACGTGGCGCAAGACAGATACGGCAACCTGTTTGTCGCTGGGACTTACCC
GGCCGCTCTGGTGCGGATAGATGCCAAAACCCGGGCAGTCGAGCCTTGGTATCTGTCATCGGCCAATTCGACTAC
CGCGGGATACTCAGGTCTAGCCATGTTCGAGTTCCGAAAGCTCCTGGTCTCGGACCAGTCAGCCGAGACGGGGAG
CAACCTCGTCTCCTTCGACGTCGACGTCAAGAGACCATCGCGTCCGAGGCCGATACCGGTGACTTGGGCTTCGAA
CGGAACTCTGACGGGCATATCGATTGAGCCCGATGCCATCGTGCTGGCCCCCAAGTATCGGGGCAAGGTTCTCCT
GGTTGCAGACAACTCCCTCGGCACCGTCGTTCTGTACTCGGACGATGGCTGGGTGACAGCCAAGAAGCTCGGAGT
CGTCCCGAGTCTGTTCTTCGGGACTACGGCGAACCCTGGCGATGCCGAGGGCCAAGTTGTTGTTTCGCTTCAGAT
CGGACAGCGCCTTTTCGCAGTGTACGAGTTCTTTCCCGATGGTGTTTACCTGTTCCCCGGGGCTCATAAGACGGC
CGGTGAGAGGACATGCTTCCCGTTGCAAGATATCACGGACGACGTGGAGAGGCTAGTGCAACAATATGTCAATAG
GGGCAGGACCATTGGCCGGGGGAGACCGACGTATCATTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail