Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00998
Gene name
Locationscaffold_01:3772974..3774792
Strand-
Gene length (bp)1818
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 4.7E-23 169 288
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 2.9E-11 456 535
PF08022 FAD_binding_8 FAD-binding domain 1.1E-07 334 447

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 134 156 22
3 171 193 22
4 206 228 22
5 243 262 19
6 274 296 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00998
MDPSPSLQIRQADATEDKVQPSSTIAPYSTALNGVNQPLNMIFKDIIWWTLGIVALTVLVVRILEILWAKLRQVS
AMSQPRDKQAYWKVSQWDWMPPLKKHLIYAPLLHKRHNREFRLSTAVNVGTLPSRLHSMLLLLYVGSNIAYMFAL
NWTVANKFAVCAELRGRSGTLAVVNMVPLIILAGRNSPLIPLLKVSFDTYNLLHRWMGRIVVAEVVVHTVAWAIP
AVASSGWSAAGAKAVKSLFIGSGFWAGVAMLLLLLVSSSPFRHAFYETFLNLHILLAVVAFIGTWIHCAAGDLPA
LPWIVAVVGLWIADRLARLFRLVFANWSSRGFTDALVEALPGDVSRVTLYLPRYVKIHPGTHAYLRFWGIRPWES
HPFSVAWVEYDAANSLPVSEKEPLTALDRKTATTSVSFIIGAQTGMTRLLYNQASKSSSGIRVRAAMEGPYAGHH
NLDSYGHVVLFAGSTGITHQISHVRHLLEGYNEGMVATRRLTLVWIIRTYETLEWVRPYMDMILRIPNRKDVLRI
QVFVTRPQNPRDIVSASSTVKMFPGRPNIPLLLVKEVQDQIGAMSVSVCGPGGLADDVRGAVRAVQGDSVIDFIE
ESFTW*
Coding >Ophcf2|00998
ATGGATCCCTCACCGTCGCTGCAAATACGGCAGGCCGACGCGACCGAGGATAAGGTACAGCCTAGCTCGACCATT
GCCCCGTATTCCACGGCGCTAAATGGCGTGAACCAGCCCCTGAATATGATATTCAAGGACATCATCTGGTGGACT
CTGGGAATCGTCGCCTTGACGGTGCTCGTCGTCAGGATCCTGGAGATTCTATGGGCGAAGCTGCGTCAGGTTTCG
GCCATGTCGCAACCGCGCGACAAGCAGGCCTACTGGAAGGTGTCGCAATGGGACTGGATGCCGCCGCTCAAGAAG
CACCTCATCTACGCTCCCCTCCTTCACAAGCGTCACAACAGAGAGTTTCGGCTCTCGACGGCCGTCAACGTCGGC
ACCCTGCCCTCGCGTCTGCATTCGATGCTGCTGCTGCTCTACGTCGGCAGCAACATCGCCTACATGTTCGCCCTC
AACTGGACCGTCGCCAACAAGTTTGCCGTCTGCGCCGAGCTTCGAGGCCGCTCCGGAACCCTGGCCGTCGTCAAC
ATGGTGCCGCTCATCATCCTGGCCGGTCGCAACAGTCCCTTGATCCCGCTGCTCAAGGTCAGCTTCGACACGTAC
AACCTGCTACACCGCTGGATGGGCCGCATCGTCGTCGCCGAGGTCGTCGTCCATACCGTCGCCTGGGCCATTCCC
GCCGTCGCCAGTTCGGGCTGGTCCGCCGCCGGCGCCAAGGCAGTCAAGAGCCTCTTTATCGGATCCGGCTTCTGG
GCCGGCGTCGCCATGCTGCTGCTGCTGCTCGTCTCGTCGTCTCCCTTCCGCCACGCCTTTTACGAGACGTTCCTC
AACTTGCACATCCTGCTCGCTGTGGTGGCCTTTATCGGAACCTGGATTCACTGTGCCGCCGGCGACCTACCCGCG
CTGCCGTGGATCGTGGCCGTCGTCGGGCTATGGATAGCCGATCGGCTGGCCCGTCTGTTCCGCCTCGTCTTCGCT
AACTGGTCCAGTCGCGGCTTCACCGACGCCCTCGTCGAGGCGCTCCCGGGCGACGTCAGCCGCGTCACGCTCTAC
CTGCCACGTTACGTCAAGATTCATCCCGGCACGCACGCCTACCTGCGCTTCTGGGGCATCCGGCCGTGGGAGAGC
CATCCGTTCTCGGTCGCCTGGGTCGAATATGACGCGGCCAACTCGTTGCCGGTGTCGGAGAAGGAGCCCTTGACG
GCCCTGGACCGCAAGACGGCGACGACGTCGGTGTCGTTCATCATCGGCGCCCAGACGGGCATGACGCGTCTCCTC
TATAACCAGGCCAGCAAGTCGTCGTCGGGCATCCGCGTCCGGGCAGCCATGGAAGGCCCCTATGCGGGACATCAC
AATCTCGACTCGTACGGTCACGTCGTCTTGTTCGCCGGCTCGACGGGCATCACGCACCAAATCTCGCACGTGCGC
CATCTGCTCGAGGGCTACAACGAAGGCATGGTGGCGACGCGGAGGCTGACGCTGGTCTGGATCATCCGCACGTAC
GAGACGCTCGAGTGGGTGCGTCCCTACATGGACATGATCCTGCGGATCCCGAACCGCAAAGACGTGCTCCGGATC
CAAGTCTTCGTCACGCGGCCTCAGAACCCACGTGACATCGTCAGCGCCAGCTCGACGGTCAAGATGTTCCCCGGC
CGGCCCAACATTCCGCTACTGCTGGTCAAGGAGGTTCAGGACCAGATCGGCGCCATGTCGGTGAGCGTGTGCGGG
CCCGGAGGTCTGGCCGACGACGTCCGGGGGGCGGTGAGGGCGGTACAGGGCGACAGCGTCATTGACTTCATCGAG
GAGAGTTTTACCTGGTGA
Transcript >Ophcf2|00998
ATGGATCCCTCACCGTCGCTGCAAATACGGCAGGCCGACGCGACCGAGGATAAGGTACAGCCTAGCTCGACCATT
GCCCCGTATTCCACGGCGCTAAATGGCGTGAACCAGCCCCTGAATATGATATTCAAGGACATCATCTGGTGGACT
CTGGGAATCGTCGCCTTGACGGTGCTCGTCGTCAGGATCCTGGAGATTCTATGGGCGAAGCTGCGTCAGGTTTCG
GCCATGTCGCAACCGCGCGACAAGCAGGCCTACTGGAAGGTGTCGCAATGGGACTGGATGCCGCCGCTCAAGAAG
CACCTCATCTACGCTCCCCTCCTTCACAAGCGTCACAACAGAGAGTTTCGGCTCTCGACGGCCGTCAACGTCGGC
ACCCTGCCCTCGCGTCTGCATTCGATGCTGCTGCTGCTCTACGTCGGCAGCAACATCGCCTACATGTTCGCCCTC
AACTGGACCGTCGCCAACAAGTTTGCCGTCTGCGCCGAGCTTCGAGGCCGCTCCGGAACCCTGGCCGTCGTCAAC
ATGGTGCCGCTCATCATCCTGGCCGGTCGCAACAGTCCCTTGATCCCGCTGCTCAAGGTCAGCTTCGACACGTAC
AACCTGCTACACCGCTGGATGGGCCGCATCGTCGTCGCCGAGGTCGTCGTCCATACCGTCGCCTGGGCCATTCCC
GCCGTCGCCAGTTCGGGCTGGTCCGCCGCCGGCGCCAAGGCAGTCAAGAGCCTCTTTATCGGATCCGGCTTCTGG
GCCGGCGTCGCCATGCTGCTGCTGCTGCTCGTCTCGTCGTCTCCCTTCCGCCACGCCTTTTACGAGACGTTCCTC
AACTTGCACATCCTGCTCGCTGTGGTGGCCTTTATCGGAACCTGGATTCACTGTGCCGCCGGCGACCTACCCGCG
CTGCCGTGGATCGTGGCCGTCGTCGGGCTATGGATAGCCGATCGGCTGGCCCGTCTGTTCCGCCTCGTCTTCGCT
AACTGGTCCAGTCGCGGCTTCACCGACGCCCTCGTCGAGGCGCTCCCGGGCGACGTCAGCCGCGTCACGCTCTAC
CTGCCACGTTACGTCAAGATTCATCCCGGCACGCACGCCTACCTGCGCTTCTGGGGCATCCGGCCGTGGGAGAGC
CATCCGTTCTCGGTCGCCTGGGTCGAATATGACGCGGCCAACTCGTTGCCGGTGTCGGAGAAGGAGCCCTTGACG
GCCCTGGACCGCAAGACGGCGACGACGTCGGTGTCGTTCATCATCGGCGCCCAGACGGGCATGACGCGTCTCCTC
TATAACCAGGCCAGCAAGTCGTCGTCGGGCATCCGCGTCCGGGCAGCCATGGAAGGCCCCTATGCGGGACATCAC
AATCTCGACTCGTACGGTCACGTCGTCTTGTTCGCCGGCTCGACGGGCATCACGCACCAAATCTCGCACGTGCGC
CATCTGCTCGAGGGCTACAACGAAGGCATGGTGGCGACGCGGAGGCTGACGCTGGTCTGGATCATCCGCACGTAC
GAGACGCTCGAGTGGGTGCGTCCCTACATGGACATGATCCTGCGGATCCCGAACCGCAAAGACGTGCTCCGGATC
CAAGTCTTCGTCACGCGGCCTCAGAACCCACGTGACATCGTCAGCGCCAGCTCGACGGTCAAGATGTTCCCCGGC
CGGCCCAACATTCCGCTACTGCTGGTCAAGGAGGTTCAGGACCAGATCGGCGCCATGTCGGTGAGCGTGTGCGGG
CCCGGAGGTCTGGCCGACGACGTCCGGGGGGCGGTGAGGGCGGTACAGGGCGACAGCGTCATTGACTTCATCGAG
GAGAGTTTTACCTGGTGA
Gene >Ophcf2|00998
ATGGATCCCTCACCGTCGCTGCAAATACGGCAGGCCGACGCGACCGAGGATAAGGTACAGCCTAGCTCGACCATT
GCCCCGTATTCCACGGCGCTAAATGGCGTGAACCAGCCCCTGAATATGATATTCAAGGACATCATCTGGTGGACT
CTGGGAATCGTCGCCTTGACGGTGCTCGTCGTCAGGATCCTGGAGATTCTATGGGCGAAGCTGCGTCAGGTTTCG
GCCATGTCGCAACCGCGCGACAAGCAGGCCTACTGGAAGGTGTCGCAATGGGACTGGATGCCGCCGCTCAAGAAG
CACCTCATCTACGCTCCCCTCCTTCACAAGCGTCACAACAGAGAGTTTCGGCTCTCGACGGCCGTCAACGTCGGC
ACCCTGCCCTCGCGTCTGCATTCGATGCTGCTGCTGCTCTACGTCGGCAGCAACATCGCCTACATGTTCGCCCTC
AACTGGACCGTCGCCAACAAGTTTGCCGTCTGCGCCGAGCTTCGAGGCCGCTCCGGAACCCTGGCCGTCGTCAAC
ATGGTGCCGCTCATCATCCTGGCCGGTCGCAACAGTCCCTTGATCCCGCTGCTCAAGGTCAGCTTCGACACGTAC
AACCTGCTACACCGCTGGATGGGCCGCATCGTCGTCGCCGAGGTCGTCGTCCATACCGTCGCCTGGGCCATTCCC
GCCGTCGCCAGTTCGGGCTGGTCCGCCGCCGGCGCCAAGGCAGTCAAGAGCCTCTTTATCGGATCCGGCTTCTGG
GCCGGCGTCGCCATGCTGCTGCTGCTGCTCGTCTCGTCGTCTCCCTTCCGCCACGCCTTTTACGAGACGTTCCTC
AACTTGCACATCCTGCTCGCTGTGGTGGCCTTTATCGGAACCTGGATTCACTGTGCCGCCGGCGACCTACCCGCG
CTGCCGTGGATCGTGGCCGTCGTCGGGCTATGGATAGCCGATCGGCTGGCCCGTCTGTTCCGCCTCGTCTTCGCT
AACTGGTCCAGTCGCGGCTTCACCGACGCCCTCGTCGAGGCGCTCCCGGGCGACGTCAGCCGCGTCACGCTCTAC
CTGCCACGTTACGTCAAGATTCATCCCGGCACGCACGCCTACCTGCGCTTCTGGGGCATCCGGCCGTGGGAGAGC
CATCCGTTCTCGGTCGCCTGGGTCGAATATGACGCGGCCAACTCGTTGCCGGTGTCGGAGAAGGAGCCCTTGACG
GCCCTGGACCGCAAGACGGCGACGACGTCGGTGTCGTTCATCATCGGCGCCCAGACGGGCATGACGCGTCTCCTC
TATAACCAGGCCAGCAAGTCGTCGTCGGGCATCCGCGTCCGGGCAGCCATGGAAGGCCCCTATGCGGGACATCAC
AATCTCGACTCGTACGGTCACGTCGTCTTGTTCGCCGGCTCGACGGGCATCACGCACCAAATCTCGCACGTGCGC
CATCTGCTCGAGGGCTACAACGAAGGCATGGTGGCGACGCGGAGGCTGACGCTGGTCTGGATCATCCGCACGTAC
GAGACGCTCGAGTGGGTGCGTCCCTACATGGACATGATCCTGCGGATCCCGAACCGCAAAGACGTGCTCCGGATC
CAAGTCTTCGTCACGCGGCCTCAGAACCCACGTGACATCGTCAGCGCCAGCTCGACGGTCAAGATGTTCCCCGGC
CGGCCCAACATTCCGCTACTGCTGGTCAAGGAGGTTCAGGACCAGATCGGCGCCATGTCGGTGAGCGTGTGCGGG
CCCGGAGGTCTGGCCGACGACGTCCGGGGGGCGGTGAGGGCGGTACAGGGCGACAGCGTCATTGACTTCATCGAG
GAGAGTTTTACCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail