Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00995
Gene name
Locationscaffold_01:3764278..3766867
Strand+
Gene length (bp)2589
Transcript length (bp)2589
Coding sequence length (bp)2589
Protein length (aa) 863

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.7E-53 481 694

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Golgi apparatus Signal peptide|Transmembrane domain 0.125 0.1247 0.0264 0.6328 0.0614 0.0124 0.565 0.4405 0.6764 0.0051

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 244 266 22
2 286 308 22
3 672 694 22
4 709 731 22
5 751 773 22
6 802 824 22
7 836 858 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Glyco_trans_2_3 1.5E-54 481 694

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup220
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4835
Ophiocordyceps australis 1348a (Ghana) OphauG2|7233
Ophiocordyceps australis map64 (Brazil) OphauB2|1479
Ophiocordyceps australis map64 (Brazil) OphauB2|3624
Ophiocordyceps camponoti-floridani Ophcf2|00995 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05069
Ophiocordyceps camponoti-rufipedis Ophun1|298
Ophiocordyceps camponoti-rufipedis Ophun1|5225
Ophiocordyceps kimflemingae Ophio5|3631
Ophiocordyceps subramaniannii Hirsu2|2492
Ophiocordyceps subramaniannii Hirsu2|3837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00995
MGLASYFTPNKAEPPPASPDKQPDTAPTTDRLMPPTPRYQSRPSSSGRSTPSTRSSVFLDDIKHEVMVNYLYQQQ
CSQLWVSDGSGEVEGVLLRKTRGCYMACPPRLGSSPFAIACAAMNLQCAMTVNSRVIKSFLQWSPDAVDVPLMGG
LRIQILPTLDDLARARKHQFAAFVASEGLLVVWDDDPLHLVQRARAIESELMELVWKAGPDAEADAEAEKRVETD
EESGETRPEKRPVHLQNSILVSLTLALVVTSLGAAWRQLAIEVSVDGNYTRLALVALCPLQIFFSLFFAQVIVGC
LAQILGPIRQLSVNSKFFSARPPSRLRTAVLPHVTIQCPVYKEGLHAVIAPTVRSVKQAMSTYELQGGSANIFIN
DDGLQLMNEVDRSARIDFYADNNIGWVARPAHRKDGFQRKGKFKKASNMNYGLKISCAVEDRLKALDRPAEWSQH
HEALTYEEVLKDVLDEDGLAWADGNVRMGDYILLIDSDTRVPPDCLLDAVSEMEQSPDVAILQFSSGVMQVVHTY
FENGIRFFTDLIYTAISYTVSSGDVAPFVGHNACLRWTAIQQVSYRDEDGYDKFWSESHVSEDFDMSLRLQTMGY
VIRLATWAGDGFREGVSLTVYDELARWEKYAYGCNELLFNPIRTWLWRGPFTPLFRRFLGSNIRFTSKITVLSYI
GTYYAIGAAWIMTVVNYFLVGWFNGYLDKYYVDSWRVWFSIVIVFNGLGNVALAVMRYRAGERTLMGLFENFKWT
LMLAIFLGGLSLHISQALLAHMFEVDISWGATSKEAEFANFFTEIPKVLKKFSMSMLFSIVSVAVMVVLAVGPVP
RDWRIDDFTAILPLSTVVASHFLLPLALNPALMTFSF*
Coding >Ophcf2|00995
ATGGGCCTCGCTTCCTACTTCACGCCGAACAAGGCCGAACCCCCTCCGGCCTCACCGGACAAGCAGCCGGACACG
GCCCCCACCACCGACCGGCTCATGCCTCCGACCCCCCGCTATCAGTCCCGGCCATCCAGCTCGGGCCGGAGCACG
CCGTCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTATCAGCAGCAG
TGCTCTCAGCTATGGGTGAGCGACGGCTCGGGCGAGGTCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTAC
ATGGCCTGTCCGCCGCGGCTGGGCAGCTCGCCTTTCGCCATTGCCTGCGCGGCCATGAATCTTCAGTGCGCCATG
ACGGTCAACTCGCGCGTCATCAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTCATGGGCGGT
CTCCGGATTCAGATATTGCCGACGCTTGATGATCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCCTTTGTCGCC
TCGGAAGGCTTACTGGTCGTCTGGGACGATGATCCCTTGCATCTGGTGCAGCGGGCGAGGGCCATAGAGTCGGAG
CTCATGGAACTGGTCTGGAAAGCCGGTCCGGACGCAGAGGCCGATGCCGAGGCCGAGAAGCGGGTCGAGACGGAC
GAGGAGAGCGGCGAGACGCGGCCCGAGAAGCGGCCCGTTCATCTACAGAACTCGATACTGGTCAGCCTGACGCTC
GCCCTCGTCGTCACTTCGCTCGGCGCTGCTTGGAGACAACTGGCCATCGAGGTCTCGGTCGATGGCAACTACACG
CGTCTGGCACTCGTCGCCCTCTGTCCGTTGCAAATCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGTTGT
CTGGCTCAGATACTCGGTCCCATTCGGCAACTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGCCTCCGTCCCGG
CTTCGGACTGCGGTGCTGCCGCACGTGACGATCCAGTGTCCCGTCTACAAGGAGGGTCTGCATGCTGTCATTGCG
CCCACTGTCAGGTCGGTCAAGCAGGCCATGTCGACCTATGAGCTTCAGGGCGGCTCGGCCAACATCTTCATCAAC
GACGATGGGCTGCAGCTCATGAACGAGGTCGATCGTTCGGCTAGGATCGACTTTTACGCCGATAATAATATTGGT
TGGGTCGCCCGTCCGGCTCATCGGAAAGACGGCTTCCAGCGAAAGGGCAAGTTCAAGAAGGCCTCCAACATGAAC
TACGGCCTCAAGATCTCGTGCGCCGTCGAGGACCGGCTCAAGGCGCTCGACCGTCCGGCTGAGTGGTCACAACAT
CACGAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTCCTGGACGAGGATGGGTTGGCATGGGCAGACGGAAAT
GTGAGGATGGGCGATTATATCCTCCTCATCGACAGTGACACTCGCGTACCGCCAGACTGCCTCCTCGATGCCGTC
TCCGAGATGGAGCAGTCGCCGGACGTGGCAATCTTGCAGTTCTCGTCGGGCGTCATGCAAGTCGTCCACACCTAC
TTCGAAAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGAGACGTC
GCTCCCTTTGTCGGTCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGC
TACGACAAGTTCTGGTCCGAGAGCCACGTGTCCGAGGACTTTGACATGTCTCTTCGTCTGCAAACCATGGGATAC
GTCATTCGACTGGCGACTTGGGCTGGCGACGGCTTCAGAGAGGGCGTCTCGCTGACTGTCTACGATGAGCTGGCT
CGTTGGGAAAAGTATGCTTATGGCTGTAATGAGCTGCTCTTCAACCCGATTCGCACCTGGCTTTGGCGTGGACCC
TTTACGCCTCTCTTCCGCCGCTTTCTGGGCTCTAATATCCGCTTCACCTCTAAGATCACCGTCCTCTCTTACATA
GGCACCTACTACGCCATCGGCGCGGCCTGGATCATGACCGTCGTCAACTACTTCCTCGTCGGCTGGTTCAACGGC
TATCTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAAC
GTCGCCCTGGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACC
CTGATGCTGGCCATCTTCCTCGGTGGCCTCTCTCTGCACATCAGCCAAGCCCTGCTTGCTCACATGTTCGAGGTC
GACATCAGCTGGGGCGCTACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTGAAG
AAGTTCTCCATGTCGATGCTCTTCTCCATTGTGTCCGTCGCCGTCATGGTTGTGCTCGCCGTCGGGCCTGTGCCG
AGAGACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTCTCGACTGTTGTTGCTAGTCATTTCTTGCTGCCG
CTGGCTTTGAATCCGGCACTGATGACGTTTTCTTTTTGA
Transcript >Ophcf2|00995
ATGGGCCTCGCTTCCTACTTCACGCCGAACAAGGCCGAACCCCCTCCGGCCTCACCGGACAAGCAGCCGGACACG
GCCCCCACCACCGACCGGCTCATGCCTCCGACCCCCCGCTATCAGTCCCGGCCATCCAGCTCGGGCCGGAGCACG
CCGTCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTATCAGCAGCAG
TGCTCTCAGCTATGGGTGAGCGACGGCTCGGGCGAGGTCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTAC
ATGGCCTGTCCGCCGCGGCTGGGCAGCTCGCCTTTCGCCATTGCCTGCGCGGCCATGAATCTTCAGTGCGCCATG
ACGGTCAACTCGCGCGTCATCAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTCATGGGCGGT
CTCCGGATTCAGATATTGCCGACGCTTGATGATCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCCTTTGTCGCC
TCGGAAGGCTTACTGGTCGTCTGGGACGATGATCCCTTGCATCTGGTGCAGCGGGCGAGGGCCATAGAGTCGGAG
CTCATGGAACTGGTCTGGAAAGCCGGTCCGGACGCAGAGGCCGATGCCGAGGCCGAGAAGCGGGTCGAGACGGAC
GAGGAGAGCGGCGAGACGCGGCCCGAGAAGCGGCCCGTTCATCTACAGAACTCGATACTGGTCAGCCTGACGCTC
GCCCTCGTCGTCACTTCGCTCGGCGCTGCTTGGAGACAACTGGCCATCGAGGTCTCGGTCGATGGCAACTACACG
CGTCTGGCACTCGTCGCCCTCTGTCCGTTGCAAATCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGTTGT
CTGGCTCAGATACTCGGTCCCATTCGGCAACTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGCCTCCGTCCCGG
CTTCGGACTGCGGTGCTGCCGCACGTGACGATCCAGTGTCCCGTCTACAAGGAGGGTCTGCATGCTGTCATTGCG
CCCACTGTCAGGTCGGTCAAGCAGGCCATGTCGACCTATGAGCTTCAGGGCGGCTCGGCCAACATCTTCATCAAC
GACGATGGGCTGCAGCTCATGAACGAGGTCGATCGTTCGGCTAGGATCGACTTTTACGCCGATAATAATATTGGT
TGGGTCGCCCGTCCGGCTCATCGGAAAGACGGCTTCCAGCGAAAGGGCAAGTTCAAGAAGGCCTCCAACATGAAC
TACGGCCTCAAGATCTCGTGCGCCGTCGAGGACCGGCTCAAGGCGCTCGACCGTCCGGCTGAGTGGTCACAACAT
CACGAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTCCTGGACGAGGATGGGTTGGCATGGGCAGACGGAAAT
GTGAGGATGGGCGATTATATCCTCCTCATCGACAGTGACACTCGCGTACCGCCAGACTGCCTCCTCGATGCCGTC
TCCGAGATGGAGCAGTCGCCGGACGTGGCAATCTTGCAGTTCTCGTCGGGCGTCATGCAAGTCGTCCACACCTAC
TTCGAAAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGAGACGTC
GCTCCCTTTGTCGGTCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGC
TACGACAAGTTCTGGTCCGAGAGCCACGTGTCCGAGGACTTTGACATGTCTCTTCGTCTGCAAACCATGGGATAC
GTCATTCGACTGGCGACTTGGGCTGGCGACGGCTTCAGAGAGGGCGTCTCGCTGACTGTCTACGATGAGCTGGCT
CGTTGGGAAAAGTATGCTTATGGCTGTAATGAGCTGCTCTTCAACCCGATTCGCACCTGGCTTTGGCGTGGACCC
TTTACGCCTCTCTTCCGCCGCTTTCTGGGCTCTAATATCCGCTTCACCTCTAAGATCACCGTCCTCTCTTACATA
GGCACCTACTACGCCATCGGCGCGGCCTGGATCATGACCGTCGTCAACTACTTCCTCGTCGGCTGGTTCAACGGC
TATCTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAAC
GTCGCCCTGGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACC
CTGATGCTGGCCATCTTCCTCGGTGGCCTCTCTCTGCACATCAGCCAAGCCCTGCTTGCTCACATGTTCGAGGTC
GACATCAGCTGGGGCGCTACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTGAAG
AAGTTCTCCATGTCGATGCTCTTCTCCATTGTGTCCGTCGCCGTCATGGTTGTGCTCGCCGTCGGGCCTGTGCCG
AGAGACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTCTCGACTGTTGTTGCTAGTCATTTCTTGCTGCCG
CTGGCTTTGAATCCGGCACTGATGACGTTTTCTTTTTGA
Gene >Ophcf2|00995
ATGGGCCTCGCTTCCTACTTCACGCCGAACAAGGCCGAACCCCCTCCGGCCTCACCGGACAAGCAGCCGGACACG
GCCCCCACCACCGACCGGCTCATGCCTCCGACCCCCCGCTATCAGTCCCGGCCATCCAGCTCGGGCCGGAGCACG
CCGTCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTATCAGCAGCAG
TGCTCTCAGCTATGGGTGAGCGACGGCTCGGGCGAGGTCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTAC
ATGGCCTGTCCGCCGCGGCTGGGCAGCTCGCCTTTCGCCATTGCCTGCGCGGCCATGAATCTTCAGTGCGCCATG
ACGGTCAACTCGCGCGTCATCAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTCATGGGCGGT
CTCCGGATTCAGATATTGCCGACGCTTGATGATCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCCTTTGTCGCC
TCGGAAGGCTTACTGGTCGTCTGGGACGATGATCCCTTGCATCTGGTGCAGCGGGCGAGGGCCATAGAGTCGGAG
CTCATGGAACTGGTCTGGAAAGCCGGTCCGGACGCAGAGGCCGATGCCGAGGCCGAGAAGCGGGTCGAGACGGAC
GAGGAGAGCGGCGAGACGCGGCCCGAGAAGCGGCCCGTTCATCTACAGAACTCGATACTGGTCAGCCTGACGCTC
GCCCTCGTCGTCACTTCGCTCGGCGCTGCTTGGAGACAACTGGCCATCGAGGTCTCGGTCGATGGCAACTACACG
CGTCTGGCACTCGTCGCCCTCTGTCCGTTGCAAATCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGTTGT
CTGGCTCAGATACTCGGTCCCATTCGGCAACTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGCCTCCGTCCCGG
CTTCGGACTGCGGTGCTGCCGCACGTGACGATCCAGTGTCCCGTCTACAAGGAGGGTCTGCATGCTGTCATTGCG
CCCACTGTCAGGTCGGTCAAGCAGGCCATGTCGACCTATGAGCTTCAGGGCGGCTCGGCCAACATCTTCATCAAC
GACGATGGGCTGCAGCTCATGAACGAGGTCGATCGTTCGGCTAGGATCGACTTTTACGCCGATAATAATATTGGT
TGGGTCGCCCGTCCGGCTCATCGGAAAGACGGCTTCCAGCGAAAGGGCAAGTTCAAGAAGGCCTCCAACATGAAC
TACGGCCTCAAGATCTCGTGCGCCGTCGAGGACCGGCTCAAGGCGCTCGACCGTCCGGCTGAGTGGTCACAACAT
CACGAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTCCTGGACGAGGATGGGTTGGCATGGGCAGACGGAAAT
GTGAGGATGGGCGATTATATCCTCCTCATCGACAGTGACACTCGCGTACCGCCAGACTGCCTCCTCGATGCCGTC
TCCGAGATGGAGCAGTCGCCGGACGTGGCAATCTTGCAGTTCTCGTCGGGCGTCATGCAAGTCGTCCACACCTAC
TTCGAAAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGAGACGTC
GCTCCCTTTGTCGGTCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGC
TACGACAAGTTCTGGTCCGAGAGCCACGTGTCCGAGGACTTTGACATGTCTCTTCGTCTGCAAACCATGGGATAC
GTCATTCGACTGGCGACTTGGGCTGGCGACGGCTTCAGAGAGGGCGTCTCGCTGACTGTCTACGATGAGCTGGCT
CGTTGGGAAAAGTATGCTTATGGCTGTAATGAGCTGCTCTTCAACCCGATTCGCACCTGGCTTTGGCGTGGACCC
TTTACGCCTCTCTTCCGCCGCTTTCTGGGCTCTAATATCCGCTTCACCTCTAAGATCACCGTCCTCTCTTACATA
GGCACCTACTACGCCATCGGCGCGGCCTGGATCATGACCGTCGTCAACTACTTCCTCGTCGGCTGGTTCAACGGC
TATCTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAAC
GTCGCCCTGGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACC
CTGATGCTGGCCATCTTCCTCGGTGGCCTCTCTCTGCACATCAGCCAAGCCCTGCTTGCTCACATGTTCGAGGTC
GACATCAGCTGGGGCGCTACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTGAAG
AAGTTCTCCATGTCGATGCTCTTCTCCATTGTGTCCGTCGCCGTCATGGTTGTGCTCGCCGTCGGGCCTGTGCCG
AGAGACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTCTCGACTGTTGTTGCTAGTCATTTCTTGCTGCCG
CTGGCTTTGAATCCGGCACTGATGACGTTTTCTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail