Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00995
Gene name
Locationscaffold_01:3764278..3766867
Strand+
Gene length (bp)2589
Transcript length (bp)2589
Coding sequence length (bp)2589
Protein length (aa) 863

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.7E-53 481 694

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 244 266 22
2 286 308 22
3 672 694 22
4 709 731 22
5 751 773 22
6 802 824 22
7 836 858 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00995
MGLASYFTPNKAEPPPASPDKQPDTAPTTDRLMPPTPRYQSRPSSSGRSTPSTRSSVFLDDIKHEVMVNYLYQQQ
CSQLWVSDGSGEVEGVLLRKTRGCYMACPPRLGSSPFAIACAAMNLQCAMTVNSRVIKSFLQWSPDAVDVPLMGG
LRIQILPTLDDLARARKHQFAAFVASEGLLVVWDDDPLHLVQRARAIESELMELVWKAGPDAEADAEAEKRVETD
EESGETRPEKRPVHLQNSILVSLTLALVVTSLGAAWRQLAIEVSVDGNYTRLALVALCPLQIFFSLFFAQVIVGC
LAQILGPIRQLSVNSKFFSARPPSRLRTAVLPHVTIQCPVYKEGLHAVIAPTVRSVKQAMSTYELQGGSANIFIN
DDGLQLMNEVDRSARIDFYADNNIGWVARPAHRKDGFQRKGKFKKASNMNYGLKISCAVEDRLKALDRPAEWSQH
HEALTYEEVLKDVLDEDGLAWADGNVRMGDYILLIDSDTRVPPDCLLDAVSEMEQSPDVAILQFSSGVMQVVHTY
FENGIRFFTDLIYTAISYTVSSGDVAPFVGHNACLRWTAIQQVSYRDEDGYDKFWSESHVSEDFDMSLRLQTMGY
VIRLATWAGDGFREGVSLTVYDELARWEKYAYGCNELLFNPIRTWLWRGPFTPLFRRFLGSNIRFTSKITVLSYI
GTYYAIGAAWIMTVVNYFLVGWFNGYLDKYYVDSWRVWFSIVIVFNGLGNVALAVMRYRAGERTLMGLFENFKWT
LMLAIFLGGLSLHISQALLAHMFEVDISWGATSKEAEFANFFTEIPKVLKKFSMSMLFSIVSVAVMVVLAVGPVP
RDWRIDDFTAILPLSTVVASHFLLPLALNPALMTFSF*
Coding >Ophcf2|00995
ATGGGCCTCGCTTCCTACTTCACGCCGAACAAGGCCGAACCCCCTCCGGCCTCACCGGACAAGCAGCCGGACACG
GCCCCCACCACCGACCGGCTCATGCCTCCGACCCCCCGCTATCAGTCCCGGCCATCCAGCTCGGGCCGGAGCACG
CCGTCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTATCAGCAGCAG
TGCTCTCAGCTATGGGTGAGCGACGGCTCGGGCGAGGTCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTAC
ATGGCCTGTCCGCCGCGGCTGGGCAGCTCGCCTTTCGCCATTGCCTGCGCGGCCATGAATCTTCAGTGCGCCATG
ACGGTCAACTCGCGCGTCATCAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTCATGGGCGGT
CTCCGGATTCAGATATTGCCGACGCTTGATGATCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCCTTTGTCGCC
TCGGAAGGCTTACTGGTCGTCTGGGACGATGATCCCTTGCATCTGGTGCAGCGGGCGAGGGCCATAGAGTCGGAG
CTCATGGAACTGGTCTGGAAAGCCGGTCCGGACGCAGAGGCCGATGCCGAGGCCGAGAAGCGGGTCGAGACGGAC
GAGGAGAGCGGCGAGACGCGGCCCGAGAAGCGGCCCGTTCATCTACAGAACTCGATACTGGTCAGCCTGACGCTC
GCCCTCGTCGTCACTTCGCTCGGCGCTGCTTGGAGACAACTGGCCATCGAGGTCTCGGTCGATGGCAACTACACG
CGTCTGGCACTCGTCGCCCTCTGTCCGTTGCAAATCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGTTGT
CTGGCTCAGATACTCGGTCCCATTCGGCAACTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGCCTCCGTCCCGG
CTTCGGACTGCGGTGCTGCCGCACGTGACGATCCAGTGTCCCGTCTACAAGGAGGGTCTGCATGCTGTCATTGCG
CCCACTGTCAGGTCGGTCAAGCAGGCCATGTCGACCTATGAGCTTCAGGGCGGCTCGGCCAACATCTTCATCAAC
GACGATGGGCTGCAGCTCATGAACGAGGTCGATCGTTCGGCTAGGATCGACTTTTACGCCGATAATAATATTGGT
TGGGTCGCCCGTCCGGCTCATCGGAAAGACGGCTTCCAGCGAAAGGGCAAGTTCAAGAAGGCCTCCAACATGAAC
TACGGCCTCAAGATCTCGTGCGCCGTCGAGGACCGGCTCAAGGCGCTCGACCGTCCGGCTGAGTGGTCACAACAT
CACGAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTCCTGGACGAGGATGGGTTGGCATGGGCAGACGGAAAT
GTGAGGATGGGCGATTATATCCTCCTCATCGACAGTGACACTCGCGTACCGCCAGACTGCCTCCTCGATGCCGTC
TCCGAGATGGAGCAGTCGCCGGACGTGGCAATCTTGCAGTTCTCGTCGGGCGTCATGCAAGTCGTCCACACCTAC
TTCGAAAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGAGACGTC
GCTCCCTTTGTCGGTCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGC
TACGACAAGTTCTGGTCCGAGAGCCACGTGTCCGAGGACTTTGACATGTCTCTTCGTCTGCAAACCATGGGATAC
GTCATTCGACTGGCGACTTGGGCTGGCGACGGCTTCAGAGAGGGCGTCTCGCTGACTGTCTACGATGAGCTGGCT
CGTTGGGAAAAGTATGCTTATGGCTGTAATGAGCTGCTCTTCAACCCGATTCGCACCTGGCTTTGGCGTGGACCC
TTTACGCCTCTCTTCCGCCGCTTTCTGGGCTCTAATATCCGCTTCACCTCTAAGATCACCGTCCTCTCTTACATA
GGCACCTACTACGCCATCGGCGCGGCCTGGATCATGACCGTCGTCAACTACTTCCTCGTCGGCTGGTTCAACGGC
TATCTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAAC
GTCGCCCTGGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACC
CTGATGCTGGCCATCTTCCTCGGTGGCCTCTCTCTGCACATCAGCCAAGCCCTGCTTGCTCACATGTTCGAGGTC
GACATCAGCTGGGGCGCTACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTGAAG
AAGTTCTCCATGTCGATGCTCTTCTCCATTGTGTCCGTCGCCGTCATGGTTGTGCTCGCCGTCGGGCCTGTGCCG
AGAGACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTCTCGACTGTTGTTGCTAGTCATTTCTTGCTGCCG
CTGGCTTTGAATCCGGCACTGATGACGTTTTCTTTTTGA
Transcript >Ophcf2|00995
ATGGGCCTCGCTTCCTACTTCACGCCGAACAAGGCCGAACCCCCTCCGGCCTCACCGGACAAGCAGCCGGACACG
GCCCCCACCACCGACCGGCTCATGCCTCCGACCCCCCGCTATCAGTCCCGGCCATCCAGCTCGGGCCGGAGCACG
CCGTCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTATCAGCAGCAG
TGCTCTCAGCTATGGGTGAGCGACGGCTCGGGCGAGGTCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTAC
ATGGCCTGTCCGCCGCGGCTGGGCAGCTCGCCTTTCGCCATTGCCTGCGCGGCCATGAATCTTCAGTGCGCCATG
ACGGTCAACTCGCGCGTCATCAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTCATGGGCGGT
CTCCGGATTCAGATATTGCCGACGCTTGATGATCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCCTTTGTCGCC
TCGGAAGGCTTACTGGTCGTCTGGGACGATGATCCCTTGCATCTGGTGCAGCGGGCGAGGGCCATAGAGTCGGAG
CTCATGGAACTGGTCTGGAAAGCCGGTCCGGACGCAGAGGCCGATGCCGAGGCCGAGAAGCGGGTCGAGACGGAC
GAGGAGAGCGGCGAGACGCGGCCCGAGAAGCGGCCCGTTCATCTACAGAACTCGATACTGGTCAGCCTGACGCTC
GCCCTCGTCGTCACTTCGCTCGGCGCTGCTTGGAGACAACTGGCCATCGAGGTCTCGGTCGATGGCAACTACACG
CGTCTGGCACTCGTCGCCCTCTGTCCGTTGCAAATCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGTTGT
CTGGCTCAGATACTCGGTCCCATTCGGCAACTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGCCTCCGTCCCGG
CTTCGGACTGCGGTGCTGCCGCACGTGACGATCCAGTGTCCCGTCTACAAGGAGGGTCTGCATGCTGTCATTGCG
CCCACTGTCAGGTCGGTCAAGCAGGCCATGTCGACCTATGAGCTTCAGGGCGGCTCGGCCAACATCTTCATCAAC
GACGATGGGCTGCAGCTCATGAACGAGGTCGATCGTTCGGCTAGGATCGACTTTTACGCCGATAATAATATTGGT
TGGGTCGCCCGTCCGGCTCATCGGAAAGACGGCTTCCAGCGAAAGGGCAAGTTCAAGAAGGCCTCCAACATGAAC
TACGGCCTCAAGATCTCGTGCGCCGTCGAGGACCGGCTCAAGGCGCTCGACCGTCCGGCTGAGTGGTCACAACAT
CACGAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTCCTGGACGAGGATGGGTTGGCATGGGCAGACGGAAAT
GTGAGGATGGGCGATTATATCCTCCTCATCGACAGTGACACTCGCGTACCGCCAGACTGCCTCCTCGATGCCGTC
TCCGAGATGGAGCAGTCGCCGGACGTGGCAATCTTGCAGTTCTCGTCGGGCGTCATGCAAGTCGTCCACACCTAC
TTCGAAAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGAGACGTC
GCTCCCTTTGTCGGTCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGC
TACGACAAGTTCTGGTCCGAGAGCCACGTGTCCGAGGACTTTGACATGTCTCTTCGTCTGCAAACCATGGGATAC
GTCATTCGACTGGCGACTTGGGCTGGCGACGGCTTCAGAGAGGGCGTCTCGCTGACTGTCTACGATGAGCTGGCT
CGTTGGGAAAAGTATGCTTATGGCTGTAATGAGCTGCTCTTCAACCCGATTCGCACCTGGCTTTGGCGTGGACCC
TTTACGCCTCTCTTCCGCCGCTTTCTGGGCTCTAATATCCGCTTCACCTCTAAGATCACCGTCCTCTCTTACATA
GGCACCTACTACGCCATCGGCGCGGCCTGGATCATGACCGTCGTCAACTACTTCCTCGTCGGCTGGTTCAACGGC
TATCTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAAC
GTCGCCCTGGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACC
CTGATGCTGGCCATCTTCCTCGGTGGCCTCTCTCTGCACATCAGCCAAGCCCTGCTTGCTCACATGTTCGAGGTC
GACATCAGCTGGGGCGCTACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTGAAG
AAGTTCTCCATGTCGATGCTCTTCTCCATTGTGTCCGTCGCCGTCATGGTTGTGCTCGCCGTCGGGCCTGTGCCG
AGAGACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTCTCGACTGTTGTTGCTAGTCATTTCTTGCTGCCG
CTGGCTTTGAATCCGGCACTGATGACGTTTTCTTTTTGA
Gene >Ophcf2|00995
ATGGGCCTCGCTTCCTACTTCACGCCGAACAAGGCCGAACCCCCTCCGGCCTCACCGGACAAGCAGCCGGACACG
GCCCCCACCACCGACCGGCTCATGCCTCCGACCCCCCGCTATCAGTCCCGGCCATCCAGCTCGGGCCGGAGCACG
CCGTCGACCCGCAGCTCCGTCTTCCTCGACGACATCAAGCACGAGGTCATGGTCAACTACCTGTATCAGCAGCAG
TGCTCTCAGCTATGGGTGAGCGACGGCTCGGGCGAGGTCGAGGGCGTGCTGCTGCGCAAGACGCGAGGCTGCTAC
ATGGCCTGTCCGCCGCGGCTGGGCAGCTCGCCTTTCGCCATTGCCTGCGCGGCCATGAATCTTCAGTGCGCCATG
ACGGTCAACTCGCGCGTCATCAAGTCCTTCTTACAGTGGTCTCCCGATGCCGTCGACGTGCCGCTCATGGGCGGT
CTCCGGATTCAGATATTGCCGACGCTTGATGATCTCGCCCGCGCTCGGAAGCATCAGTTTGCTGCCTTTGTCGCC
TCGGAAGGCTTACTGGTCGTCTGGGACGATGATCCCTTGCATCTGGTGCAGCGGGCGAGGGCCATAGAGTCGGAG
CTCATGGAACTGGTCTGGAAAGCCGGTCCGGACGCAGAGGCCGATGCCGAGGCCGAGAAGCGGGTCGAGACGGAC
GAGGAGAGCGGCGAGACGCGGCCCGAGAAGCGGCCCGTTCATCTACAGAACTCGATACTGGTCAGCCTGACGCTC
GCCCTCGTCGTCACTTCGCTCGGCGCTGCTTGGAGACAACTGGCCATCGAGGTCTCGGTCGATGGCAACTACACG
CGTCTGGCACTCGTCGCCCTCTGTCCGTTGCAAATCTTCTTTTCCCTCTTCTTCGCCCAGGTCATCGTCGGTTGT
CTGGCTCAGATACTCGGTCCCATTCGGCAACTGTCGGTCAACTCCAAGTTCTTCTCGGCTCGGCCTCCGTCCCGG
CTTCGGACTGCGGTGCTGCCGCACGTGACGATCCAGTGTCCCGTCTACAAGGAGGGTCTGCATGCTGTCATTGCG
CCCACTGTCAGGTCGGTCAAGCAGGCCATGTCGACCTATGAGCTTCAGGGCGGCTCGGCCAACATCTTCATCAAC
GACGATGGGCTGCAGCTCATGAACGAGGTCGATCGTTCGGCTAGGATCGACTTTTACGCCGATAATAATATTGGT
TGGGTCGCCCGTCCGGCTCATCGGAAAGACGGCTTCCAGCGAAAGGGCAAGTTCAAGAAGGCCTCCAACATGAAC
TACGGCCTCAAGATCTCGTGCGCCGTCGAGGACCGGCTCAAGGCGCTCGACCGTCCGGCTGAGTGGTCACAACAT
CACGAGGCTCTGACGTACGAGGAGGTCCTCAAGGATGTCCTGGACGAGGATGGGTTGGCATGGGCAGACGGAAAT
GTGAGGATGGGCGATTATATCCTCCTCATCGACAGTGACACTCGCGTACCGCCAGACTGCCTCCTCGATGCCGTC
TCCGAGATGGAGCAGTCGCCGGACGTGGCAATCTTGCAGTTCTCGTCGGGCGTCATGCAAGTCGTCCACACCTAC
TTCGAAAACGGCATCCGCTTCTTCACCGACCTCATCTATACCGCCATCTCTTACACCGTTTCCTCGGGAGACGTC
GCTCCCTTTGTCGGTCACAACGCCTGTCTCCGCTGGACGGCCATCCAGCAGGTCTCGTATCGCGACGAAGACGGC
TACGACAAGTTCTGGTCCGAGAGCCACGTGTCCGAGGACTTTGACATGTCTCTTCGTCTGCAAACCATGGGATAC
GTCATTCGACTGGCGACTTGGGCTGGCGACGGCTTCAGAGAGGGCGTCTCGCTGACTGTCTACGATGAGCTGGCT
CGTTGGGAAAAGTATGCTTATGGCTGTAATGAGCTGCTCTTCAACCCGATTCGCACCTGGCTTTGGCGTGGACCC
TTTACGCCTCTCTTCCGCCGCTTTCTGGGCTCTAATATCCGCTTCACCTCTAAGATCACCGTCCTCTCTTACATA
GGCACCTACTACGCCATCGGCGCGGCCTGGATCATGACCGTCGTCAACTACTTCCTCGTCGGCTGGTTCAACGGC
TATCTCGACAAGTACTACGTCGATTCTTGGAGGGTCTGGTTCTCCATCGTCATCGTCTTCAACGGGCTGGGCAAC
GTCGCCCTGGCCGTGATGCGCTACCGAGCCGGCGAGCGGACCCTCATGGGCCTATTCGAGAACTTCAAGTGGACC
CTGATGCTGGCCATCTTCCTCGGTGGCCTCTCTCTGCACATCAGCCAAGCCCTGCTTGCTCACATGTTCGAGGTC
GACATCAGCTGGGGCGCTACCAGCAAGGAGGCCGAGTTCGCAAACTTCTTCACCGAGATTCCCAAGGTTCTGAAG
AAGTTCTCCATGTCGATGCTCTTCTCCATTGTGTCCGTCGCCGTCATGGTTGTGCTCGCCGTCGGGCCTGTGCCG
AGAGACTGGCGCATCGACGACTTTACCGCCATTCTGCCGCTCTCGACTGTTGTTGCTAGTCATTTCTTGCTGCCG
CTGGCTTTGAATCCGGCACTGATGACGTTTTCTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail