Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00993
Gene name
Locationscaffold_01:3759437..3760632
Strand+
Gene length (bp)1195
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.5E-14 73 141

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 301 323 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 61.11 33.42 88.80
Alive In ants, during behavior modification 122.32 70.07 174.56
Dead In ants, recently dead 126.26 72.42 180.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.876312 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00993
MASRSYRSVTRSPTPPPVDSRSGHRRRLGSPSQSRSPTPPPRRPRADSRSWSRGRARDSREPSETSHPSGTKVVV
ERLSKNVRESHLREIFGHYGPIQDLDLPFNRAFGTNRGTAYILYEHREDAEEAVANMHEGHIDGATVNVSIVLPR
RIFSPEPPLARRGANIDPRVPMPNSRGGRGYRGHPAPVGHRRASSPSRYGHRTNNAFAPPSRSRSRSPYRTPPKP
SRASRGGGGPRRSFDSYSSRSRSKSPPPRRSGGGSGGRFANDGFRRRSRSVDSYGGGGRNRSPSPVRNNYWFHKG
LLVFFIGMAACGCLSVQATCVYTG*
Coding >Ophcf2|00993
ATGGCTTCGCGCTCGTACCGCTCCGTGACGCGCTCGCCGACGCCGCCGCCCGTCGATTCTCGCTCTGGTCACCGG
CGTCGGCTCGGCTCACCCTCGCAGTCGCGTTCGCCGACGCCTCCTCCGCGTCGTCCCCGAGCCGACAGCCGGAGC
TGGAGCCGCGGCCGAGCGAGGGACAGCCGTGAGCCGAGCGAGACTTCGCATCCGTCTGGGACCAAGGTTGTGGTC
GAGCGGCTGTCGAAGAACGTGCGGGAGTCTCATCTTCGCGAGATTTTCGGTCATTACGGCCCGATTCAGGATCTC
GACCTCCCCTTCAATAGAGCTTTTGGTACGAACCGCGGCACCGCCTATATCCTCTACGAGCATCGCGAAGACGCC
GAGGAGGCCGTCGCCAACATGCACGAGGGCCACATCGACGGCGCCACCGTCAACGTCTCCATCGTCCTGCCGCGA
CGCATCTTCTCGCCCGAACCACCTCTGGCCCGACGAGGCGCCAATATCGATCCTCGCGTTCCGATGCCCAACTCA
CGCGGCGGGCGTGGCTACCGCGGCCATCCTGCGCCTGTTGGTCATCGTCGAGCCTCCTCTCCCAGCCGCTACGGT
CATCGGACAAACAACGCCTTTGCGCCTCCCTCGCGCTCCCGCTCCCGTTCACCTTATAGGACGCCTCCGAAGCCG
TCTCGTGCTTCTCGCGGTGGTGGCGGGCCGCGCCGCTCGTTTGACTCTTATTCGTCCCGCTCAAGGTCCAAGTCG
CCTCCCCCGCGGCGGAGCGGAGGAGGAAGTGGCGGACGCTTTGCCAATGATGGCTTCCGTCGCCGCAGCCGTAGC
GTCGACAGTTACGGAGGTGGAGGCCGCAACCGATCCCCCAGCCCGGTGCGGAACAACTACTGGTTTCATAAGGGC
CTTTTGGTCTTTTTCATTGGGATGGCGGCGTGCGGTTGCCTATCCGTACAGGCCACGTGTGTATATACGGGTTGA
Transcript >Ophcf2|00993
ATGGCTTCGCGCTCGTACCGCTCCGTGACGCGCTCGCCGACGCCGCCGCCCGTCGATTCTCGCTCTGGTCACCGG
CGTCGGCTCGGCTCACCCTCGCAGTCGCGTTCGCCGACGCCTCCTCCGCGTCGTCCCCGAGCCGACAGCCGGAGC
TGGAGCCGCGGCCGAGCGAGGGACAGCCGTGAGCCGAGCGAGACTTCGCATCCGTCTGGGACCAAGGTTGTGGTC
GAGCGGCTGTCGAAGAACGTGCGGGAGTCTCATCTTCGCGAGATTTTCGGTCATTACGGCCCGATTCAGGATCTC
GACCTCCCCTTCAATAGAGCTTTTGGTACGAACCGCGGCACCGCCTATATCCTCTACGAGCATCGCGAAGACGCC
GAGGAGGCCGTCGCCAACATGCACGAGGGCCACATCGACGGCGCCACCGTCAACGTCTCCATCGTCCTGCCGCGA
CGCATCTTCTCGCCCGAACCACCTCTGGCCCGACGAGGCGCCAATATCGATCCTCGCGTTCCGATGCCCAACTCA
CGCGGCGGGCGTGGCTACCGCGGCCATCCTGCGCCTGTTGGTCATCGTCGAGCCTCCTCTCCCAGCCGCTACGGT
CATCGGACAAACAACGCCTTTGCGCCTCCCTCGCGCTCCCGCTCCCGTTCACCTTATAGGACGCCTCCGAAGCCG
TCTCGTGCTTCTCGCGGTGGTGGCGGGCCGCGCCGCTCGTTTGACTCTTATTCGTCCCGCTCAAGGTCCAAGTCG
CCTCCCCCGCGGCGGAGCGGAGGAGGAAGTGGCGGACGCTTTGCCAATGATGGCTTCCGTCGCCGCAGCCGTAGC
GTCGACAGTTACGGAGGTGGAGGCCGCAACCGATCCCCCAGCCCGGTGCGGAACAACTACTGGTTTCATAAGGGC
CTTTTGGTCTTTTTCATTGGGATGGCGGCGTGCGGTTGCCTATCCGTACAGGCCACGTGTGTATATACGGGTTGA
Gene >Ophcf2|00993
ATGGCTTCGCGCTCGTACCGCTCCGTGACGCGCTCGCCGACGCCGCCGCCCGTCGATTCTCGCTCTGGTCACCGG
CGTCGGCTCGGCTCACCCTCGCAGTCGCGTTCGCCGACGCCTCCTCCGCGTCGTCCCCGAGCCGACAGCCGGAGC
TGGAGCCGCGGCCGAGCGAGGGACAGCCGTGAGCCGAGCGAGACTTCGCATCCGTCTGGGACCAAGGTTCGTCTT
ATCTTCTCGTCTGTCTGCTTGCTCACTGCTGATGCATCTCAGGTTGTGGTCGAGCGGCTGTCGAAGAACGTGCGG
GAGTCTCATCTTCGCGAGATTTTCGGTCATTACGGCCCGATTCAGGATCTCGACCTCCCCTTCAATAGAGCTTGT
GAGCTTATTCTTTTCCATACTCACATACTCGACGACAGATTCTGACGATTATTACCAGTTGGTACGAACCGCGGC
ACCGCCTATATCCTCTACGAGCATCGCGAAGACGCCGAGGAGGCCGTCGCCAACATGCACGAGGGCCACATCGAC
GGCGCCACCGTCAACGTCTCCATCGTCCTGCCGCGACGCATCTTCTCGCCCGAACCACCTCTGGCCCGACGAGGC
GCCAATATCGATCCTCGCGTTCCGATGCCCAACTCACGCGGCGGGCGTGGCTACCGCGGCCATCCTGCGCCTGTT
GGTCATCGTCGAGCCTCCTCTCCCAGCCGCTACGGTCATCGGACAAACAACGCCTTTGCGCCTCCCTCGCGCTCC
CGCTCCCGTTCACCTTATAGGACGCCTCCGAAGCCGTCTCGTGCTTCTCGCGGTGGTGGCGGGCCGCGCCGCTCG
TTTGACTCTTATTCGTCCCGCTCAAGGTCCAAGTCGCCTCCCCCGCGGCGGAGCGGAGGAGGAAGTGGCGGACGC
TTTGCCAATGATGGCTTCCGTCGCCGCAGCCGTAGCGTCGACAGTTACGGAGGTGGAGGCCGCAACCGATCCCCC
AGCCCGGTGCGGAACAACTACTGGTAGCGACACACCAGGGATTCAATCAAGGTCAGATATGAGCCTTGTCATCCT
AGGTTTCATAAGGGCCTTTTGGTCTTTTTCATTGGGATGGCGGCGTGCGGTTGGTACGAATGATTTCTATTTCTT
TCGCAGAGGGGCACGTTTTCTAACACGCCACAGCCTATCCGTACAGGCCACGTGTGTATATACGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail