Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00993
Gene name
Locationscaffold_01:3759437..3760632
Strand+
Gene length (bp)1195
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.5E-14 73 141

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 301 323 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00993
MASRSYRSVTRSPTPPPVDSRSGHRRRLGSPSQSRSPTPPPRRPRADSRSWSRGRARDSREPSETSHPSGTKVVV
ERLSKNVRESHLREIFGHYGPIQDLDLPFNRAFGTNRGTAYILYEHREDAEEAVANMHEGHIDGATVNVSIVLPR
RIFSPEPPLARRGANIDPRVPMPNSRGGRGYRGHPAPVGHRRASSPSRYGHRTNNAFAPPSRSRSRSPYRTPPKP
SRASRGGGGPRRSFDSYSSRSRSKSPPPRRSGGGSGGRFANDGFRRRSRSVDSYGGGGRNRSPSPVRNNYWFHKG
LLVFFIGMAACGCLSVQATCVYTG*
Coding >Ophcf2|00993
ATGGCTTCGCGCTCGTACCGCTCCGTGACGCGCTCGCCGACGCCGCCGCCCGTCGATTCTCGCTCTGGTCACCGG
CGTCGGCTCGGCTCACCCTCGCAGTCGCGTTCGCCGACGCCTCCTCCGCGTCGTCCCCGAGCCGACAGCCGGAGC
TGGAGCCGCGGCCGAGCGAGGGACAGCCGTGAGCCGAGCGAGACTTCGCATCCGTCTGGGACCAAGGTTGTGGTC
GAGCGGCTGTCGAAGAACGTGCGGGAGTCTCATCTTCGCGAGATTTTCGGTCATTACGGCCCGATTCAGGATCTC
GACCTCCCCTTCAATAGAGCTTTTGGTACGAACCGCGGCACCGCCTATATCCTCTACGAGCATCGCGAAGACGCC
GAGGAGGCCGTCGCCAACATGCACGAGGGCCACATCGACGGCGCCACCGTCAACGTCTCCATCGTCCTGCCGCGA
CGCATCTTCTCGCCCGAACCACCTCTGGCCCGACGAGGCGCCAATATCGATCCTCGCGTTCCGATGCCCAACTCA
CGCGGCGGGCGTGGCTACCGCGGCCATCCTGCGCCTGTTGGTCATCGTCGAGCCTCCTCTCCCAGCCGCTACGGT
CATCGGACAAACAACGCCTTTGCGCCTCCCTCGCGCTCCCGCTCCCGTTCACCTTATAGGACGCCTCCGAAGCCG
TCTCGTGCTTCTCGCGGTGGTGGCGGGCCGCGCCGCTCGTTTGACTCTTATTCGTCCCGCTCAAGGTCCAAGTCG
CCTCCCCCGCGGCGGAGCGGAGGAGGAAGTGGCGGACGCTTTGCCAATGATGGCTTCCGTCGCCGCAGCCGTAGC
GTCGACAGTTACGGAGGTGGAGGCCGCAACCGATCCCCCAGCCCGGTGCGGAACAACTACTGGTTTCATAAGGGC
CTTTTGGTCTTTTTCATTGGGATGGCGGCGTGCGGTTGCCTATCCGTACAGGCCACGTGTGTATATACGGGTTGA
Transcript >Ophcf2|00993
ATGGCTTCGCGCTCGTACCGCTCCGTGACGCGCTCGCCGACGCCGCCGCCCGTCGATTCTCGCTCTGGTCACCGG
CGTCGGCTCGGCTCACCCTCGCAGTCGCGTTCGCCGACGCCTCCTCCGCGTCGTCCCCGAGCCGACAGCCGGAGC
TGGAGCCGCGGCCGAGCGAGGGACAGCCGTGAGCCGAGCGAGACTTCGCATCCGTCTGGGACCAAGGTTGTGGTC
GAGCGGCTGTCGAAGAACGTGCGGGAGTCTCATCTTCGCGAGATTTTCGGTCATTACGGCCCGATTCAGGATCTC
GACCTCCCCTTCAATAGAGCTTTTGGTACGAACCGCGGCACCGCCTATATCCTCTACGAGCATCGCGAAGACGCC
GAGGAGGCCGTCGCCAACATGCACGAGGGCCACATCGACGGCGCCACCGTCAACGTCTCCATCGTCCTGCCGCGA
CGCATCTTCTCGCCCGAACCACCTCTGGCCCGACGAGGCGCCAATATCGATCCTCGCGTTCCGATGCCCAACTCA
CGCGGCGGGCGTGGCTACCGCGGCCATCCTGCGCCTGTTGGTCATCGTCGAGCCTCCTCTCCCAGCCGCTACGGT
CATCGGACAAACAACGCCTTTGCGCCTCCCTCGCGCTCCCGCTCCCGTTCACCTTATAGGACGCCTCCGAAGCCG
TCTCGTGCTTCTCGCGGTGGTGGCGGGCCGCGCCGCTCGTTTGACTCTTATTCGTCCCGCTCAAGGTCCAAGTCG
CCTCCCCCGCGGCGGAGCGGAGGAGGAAGTGGCGGACGCTTTGCCAATGATGGCTTCCGTCGCCGCAGCCGTAGC
GTCGACAGTTACGGAGGTGGAGGCCGCAACCGATCCCCCAGCCCGGTGCGGAACAACTACTGGTTTCATAAGGGC
CTTTTGGTCTTTTTCATTGGGATGGCGGCGTGCGGTTGCCTATCCGTACAGGCCACGTGTGTATATACGGGTTGA
Gene >Ophcf2|00993
ATGGCTTCGCGCTCGTACCGCTCCGTGACGCGCTCGCCGACGCCGCCGCCCGTCGATTCTCGCTCTGGTCACCGG
CGTCGGCTCGGCTCACCCTCGCAGTCGCGTTCGCCGACGCCTCCTCCGCGTCGTCCCCGAGCCGACAGCCGGAGC
TGGAGCCGCGGCCGAGCGAGGGACAGCCGTGAGCCGAGCGAGACTTCGCATCCGTCTGGGACCAAGGTTCGTCTT
ATCTTCTCGTCTGTCTGCTTGCTCACTGCTGATGCATCTCAGGTTGTGGTCGAGCGGCTGTCGAAGAACGTGCGG
GAGTCTCATCTTCGCGAGATTTTCGGTCATTACGGCCCGATTCAGGATCTCGACCTCCCCTTCAATAGAGCTTGT
GAGCTTATTCTTTTCCATACTCACATACTCGACGACAGATTCTGACGATTATTACCAGTTGGTACGAACCGCGGC
ACCGCCTATATCCTCTACGAGCATCGCGAAGACGCCGAGGAGGCCGTCGCCAACATGCACGAGGGCCACATCGAC
GGCGCCACCGTCAACGTCTCCATCGTCCTGCCGCGACGCATCTTCTCGCCCGAACCACCTCTGGCCCGACGAGGC
GCCAATATCGATCCTCGCGTTCCGATGCCCAACTCACGCGGCGGGCGTGGCTACCGCGGCCATCCTGCGCCTGTT
GGTCATCGTCGAGCCTCCTCTCCCAGCCGCTACGGTCATCGGACAAACAACGCCTTTGCGCCTCCCTCGCGCTCC
CGCTCCCGTTCACCTTATAGGACGCCTCCGAAGCCGTCTCGTGCTTCTCGCGGTGGTGGCGGGCCGCGCCGCTCG
TTTGACTCTTATTCGTCCCGCTCAAGGTCCAAGTCGCCTCCCCCGCGGCGGAGCGGAGGAGGAAGTGGCGGACGC
TTTGCCAATGATGGCTTCCGTCGCCGCAGCCGTAGCGTCGACAGTTACGGAGGTGGAGGCCGCAACCGATCCCCC
AGCCCGGTGCGGAACAACTACTGGTAGCGACACACCAGGGATTCAATCAAGGTCAGATATGAGCCTTGTCATCCT
AGGTTTCATAAGGGCCTTTTGGTCTTTTTCATTGGGATGGCGGCGTGCGGTTGGTACGAATGATTTCTATTTCTT
TCGCAGAGGGGCACGTTTTCTAACACGCCACAGCCTATCCGTACAGGCCACGTGTGTATATACGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail