Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00990
Gene name
Locationscaffold_01:3745444..3751508
Strand-
Gene length (bp)6064
Transcript length (bp)5934
Coding sequence length (bp)5934
Protein length (aa) 1978

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13087 AAA_12 AAA domain 3.0E-38 960 1190
PF13086 AAA_11 AAA domain 1.5E-23 618 943
PF20173 DUF6539 Family of unknown function (DUF6539) 2.6E-22 1909 1961
PF13245 AAA_19 AAA domain 1.4E-08 622 939

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140657 ATP-dependent activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5702 0.6163 0.0791 0.0396 0.0781 0.0079 0.1318 0.2848 0.2045 0.009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4825
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6189
Ophiocordyceps camponoti-floridani Ophcf2|00990 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|303
Ophiocordyceps kimflemingae Ophio5|4555
Ophiocordyceps subramaniannii Hirsu2|10694

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00990
MAGKGDSPDITNQPQPCLHFKRHGICKFGQHCKFSHDVSADHGLVQEAASDSPPPSRPLLDGKYQQWKRILRQSS
ITSCPSAMATTDFFRLGLELMDSDVGVSQEVVKQLATDPGLLLINTVAENSIQGYPSPYVAIWTSQLEPLFQLLT
HPRLIDSAVLEQQVALIYNYLLGVGGVRMTRIFDYIGRLLKSWPTDPMPVVELSLAVLSKILDCNTTNIVNESFS
TFVALFSHQVSNSNEPEQALSRLQASKYLDYMRLRLDSGNEIRKLTSRSKAKPVRQQFVLRRELPGHLSAQGPRH
DNDHAEIPKIKILPTWEEIMSARAEYLPLADSSQWHVKGIHGRLDREFRLLREDTVGQVRDAVFQALQKMRNPTG
VGEARGLKNSAPTYTYSKPTAIDAYFDRFSGLEMTIRCMQPLAAQRIKATDREAWWMQSKRLQVGALVCAVNPTG
SVLFFVVSNSTMRSKADIKHTRQTKSTEDDDAPVEHLTLSDDAKFLFVKLQLASTNEQEVALALRWYRTIESGPA
WCLVEFPGILLASFKYTLEALQRMYQKLDIPFCKILAPSESTSGPAVMDPPLYARAPGFAFSMRCLSNDDRELVS
SLRAPLTPSQLASRSCLDPTQAAALLNTLSREVSLIQGPPGTGKSYTGEKIIKVLLENRKQAKLGPILCVCYTNH
ALDQVLEHLLDEGIENIIRIGSRSKSDRLGKLNLVEVAKACSRTKAEKYRLYEVEASVRFIKKQVDQELDKLKTM
NSWSTLKAHLFTANRKHHDELFGKKKKGEPGWTRVVHSSQDRSLERWLHGELREEEGQRHVEGQRHVEELLGAEL
ASMNHAERRELYNHWLHNIRDEATTVVQNLYDDFNEAAETRARARHDVDLRCLQNAQVVGVTTTGLARCLDLLRK
VRCKVVVCEEAGEVLEAHILTALLPTVEHAILIGDHLQLRPQIQNYELQSTNPRGREYSLDVSLFERLVKPDDGG
ERRLPLSVLETQRRMHPDMAELIRSTLYPNLKNSEAVTQHPEVVGLRERLFWLHHEKQEAAAANYDAYGTSHRND
YEVEMTVSLVSHLFRQGKYSHGDIAVLTPYLSQLHQLRRRMQTMFEISVGDRDLEALEAVEGDGKTVPPISRALL
NRSTLLKSVRAATVDNFQGEEAKVVVISLVRSNQQNRCGFLSTSNRINVLLSRARDGMYIIGNAKTYEHVPMWAE
VIAMLKASSRFGTSLELQCPRHPKDRLTVSKPDDFLQMSPESGCNLPCDRRLDCGHACTGRCHSDMLHQAVKCLE
ACPRPKKGCNHPCPLLCGEVCHGRCQVQMEEGVELPCGHRHAPASCWEVRHPNSVRCKTMVMRTVPGCQHRVLML
CYQDVASTSFNCSSPCGHVRACGHKCRRPCSRCNTRQDGKVTERNHGICQVKCGRNFTTCPHSCSLKCHGDSPCP
PCKETCQASCGHSRCEKACSEPCGPCAEATCLSRCPHSQCTMPCAAPCNWVPCTKRCLERLACGHQCPSLCGEQC
PDEGFCQQCGPQEIKSMQVDVIKMREYKDINLDVEPCIFPQCGHFLTVTSMDGQMDMQAHYELDRDGRPTAISRP
SEPMTLAGKSIPVCGSCRGSLRSIARYGRIVRRALLDEATKKLITWCADEHLSLAEKLGSEVDKLAERPVPETVP
LSHDDEDDKDDDDDDDDDGEKAKGALHHITPRLRPLLLLSKLVGHQRYDSILVLWRTLHQHAARVREEEQPFQRV
ADLVRHGNRLKHTSHEFVFDESVIQLKGWLSAETLLLECELVVLDDFSQLRKKTPWNQIEVEVDLSTCFNACRYL
IDLTSVSKHPREEVRGHIFAARLSGLSLALDSYPPVRGAFDPFSIVATAEQARAEGLYHIHRARTLVSALPSAAE
MLKPAIDAAETRLNHGIYRPVTASELRSVTSAMAAELRGTGHWYMCANGHPFTLGECGMPMERASCPECGAAIGG
IQHRLFEGVRRATEMDDLVGGLERLGM*
Coding >Ophcf2|00990
ATGGCGGGAAAAGGCGATTCCCCCGATATCACGAACCAGCCGCAGCCATGCTTGCATTTTAAACGGCACGGAATC
TGCAAGTTCGGCCAGCATTGCAAATTCTCCCATGATGTCTCCGCCGACCATGGTCTGGTACAAGAGGCGGCATCT
GACTCTCCTCCTCCATCCCGACCGCTTCTCGACGGCAAATACCAGCAGTGGAAGCGCATCCTGCGACAGAGTTCC
ATCACTTCATGCCCTTCCGCGATGGCAACCACCGACTTCTTTCGGCTGGGCCTTGAGTTGATGGACAGTGACGTT
GGCGTTTCCCAGGAGGTGGTGAAGCAGTTGGCCACTGATCCCGGCCTGCTGCTCATCAATACGGTCGCCGAGAAC
AGCATTCAAGGATATCCCTCCCCCTACGTTGCAATCTGGACCTCGCAGCTGGAGCCGTTGTTCCAGCTGTTAACG
CACCCCCGTCTCATCGACTCTGCCGTACTGGAGCAGCAGGTGGCCCTCATCTACAACTACCTCCTCGGAGTAGGA
GGCGTCCGCATGACAAGAATCTTCGACTACATCGGTCGCCTGCTCAAAAGCTGGCCGACGGATCCCATGCCTGTC
GTTGAGCTGTCCCTCGCTGTTCTCTCCAAGATTCTTGACTGCAATACGACCAATATTGTCAACGAGAGCTTCTCC
ACCTTTGTTGCGCTCTTCTCCCACCAAGTGAGCAACAGTAATGAGCCGGAGCAGGCACTCTCTCGCTTGCAGGCC
AGCAAATATCTCGACTACATGCGACTCCGGCTTGACTCTGGCAACGAGATTCGGAAATTGACCTCGAGGTCGAAA
GCAAAACCGGTTCGCCAACAGTTTGTCCTGCGGAGGGAGCTCCCCGGTCACCTATCAGCCCAAGGCCCACGTCAC
GACAACGACCATGCAGAGATTCCAAAAATCAAGATTTTGCCGACGTGGGAAGAGATCATGTCTGCGAGGGCCGAA
TACTTGCCCCTTGCAGACAGCTCTCAGTGGCACGTCAAGGGCATTCACGGACGCTTAGATCGCGAGTTCCGCCTC
TTGCGCGAGGACACCGTGGGCCAGGTCAGAGACGCCGTGTTTCAAGCTCTCCAAAAGATGCGCAACCCGACAGGC
GTGGGAGAGGCGCGCGGGCTCAAGAATAGCGCGCCTACATACACCTACAGCAAACCGACGGCCATAGACGCTTAC
TTTGACAGGTTCTCCGGCTTGGAGATGACCATTCGTTGCATGCAACCTCTTGCGGCCCAGAGAATAAAGGCCACG
GATCGGGAAGCCTGGTGGATGCAGAGCAAGCGCCTTCAGGTGGGAGCCTTGGTTTGTGCCGTGAATCCAACGGGC
TCTGTTCTATTTTTCGTTGTTTCCAACTCGACCATGAGAAGTAAAGCCGATATCAAACACACTCGCCAGACGAAA
TCCACCGAGGATGATGACGCACCGGTCGAGCACCTGACCCTCTCTGACGATGCCAAGTTTCTCTTCGTCAAGCTC
CAGCTGGCTAGCACCAATGAACAAGAGGTCGCCCTGGCTTTGCGATGGTATCGAACCATAGAGTCCGGGCCTGCT
TGGTGCTTGGTCGAATTCCCCGGCATCCTCCTTGCGTCGTTCAAGTATACGCTTGAAGCCTTGCAGCGCATGTAC
CAGAAGCTGGACATTCCGTTTTGCAAGATCTTGGCGCCGTCAGAGTCCACGTCCGGCCCTGCCGTCATGGATCCT
CCGCTCTACGCCAGAGCGCCTGGCTTTGCCTTTAGCATGAGATGCCTGAGCAACGACGACAGGGAGCTGGTATCT
TCGCTTCGCGCCCCTCTTACGCCTAGCCAGCTCGCGTCCCGGTCTTGCCTTGATCCCACCCAGGCTGCGGCCCTA
TTGAACACTTTATCGCGCGAAGTCTCCCTCATCCAGGGCCCTCCTGGCACCGGCAAGAGCTACACCGGGGAGAAG
ATTATCAAAGTCTTGCTGGAGAACAGAAAGCAAGCCAAGCTGGGGCCCATTCTTTGCGTCTGCTACACCAACCAC
GCGCTGGATCAGGTGCTCGAGCACTTGCTCGATGAAGGCATCGAAAACATTATACGCATAGGCTCGCGGTCGAAA
TCCGACAGGCTGGGCAAGTTGAACCTGGTGGAGGTGGCCAAAGCATGCAGCCGGACGAAGGCAGAAAAGTACAGG
CTATATGAAGTCGAGGCGTCAGTCCGGTTTATCAAGAAGCAGGTAGACCAAGAACTCGACAAGCTCAAGACGATG
AATTCCTGGTCAACGCTGAAAGCTCACCTCTTTACGGCGAATCGTAAACACCACGACGAGTTGTTCGGCAAAAAG
AAGAAAGGCGAGCCGGGATGGACACGTGTGGTGCATTCTTCGCAAGACCGATCGCTTGAAAGGTGGTTGCATGGG
GAACTACGCGAAGAGGAGGGGCAACGACACGTCGAGGGGCAACGACATGTCGAGGAGCTCCTGGGCGCTGAGCTC
GCCAGTATGAACCACGCAGAGCGAAGGGAACTATACAATCATTGGCTTCACAACATCCGCGACGAGGCCACCACC
GTTGTCCAAAACCTATACGACGACTTTAACGAGGCGGCCGAGACGCGGGCTCGCGCGCGCCACGACGTGGATCTG
CGCTGTCTTCAGAATGCCCAGGTGGTAGGCGTCACCACGACCGGACTGGCCAGATGCTTGGACCTTCTCCGCAAG
GTCCGATGCAAAGTGGTGGTGTGCGAGGAGGCGGGAGAAGTCCTCGAAGCACACATTCTCACCGCCCTCCTCCCG
ACGGTAGAGCATGCCATCCTGATCGGCGACCATCTCCAGCTCCGGCCGCAAATTCAAAATTACGAGCTGCAGAGC
ACGAACCCGCGCGGACGCGAGTACTCTCTCGATGTCTCACTGTTTGAGCGGCTTGTGAAGCCGGACGATGGCGGC
GAGAGGCGCTTACCCCTGAGCGTGCTGGAGACGCAGAGACGTATGCACCCCGACATGGCCGAGCTCATTCGCTCG
ACGCTCTATCCGAATCTGAAGAACTCCGAGGCGGTTACGCAGCATCCGGAAGTTGTCGGCCTCCGCGAGCGGTTG
TTCTGGCTCCATCATGAGAAGCAAGAGGCGGCGGCCGCAAACTACGATGCATACGGCACATCACACCGCAACGAC
TACGAGGTCGAGATGACGGTCTCTCTGGTATCCCATCTGTTCCGGCAGGGAAAGTACTCTCATGGCGACATTGCC
GTCTTGACGCCCTACCTCAGCCAGCTCCATCAGCTGCGACGACGGATGCAAACCATGTTTGAAATTAGTGTCGGC
GACCGCGATCTCGAAGCGCTCGAAGCGGTTGAGGGCGATGGCAAGACTGTGCCACCAATTTCCAGGGCGCTGCTG
AACCGATCGACGCTCCTCAAAAGTGTCCGAGCCGCGACCGTCGACAATTTCCAGGGCGAGGAGGCCAAGGTGGTG
GTCATATCCCTGGTTCGCAGCAACCAACAGAACAGATGCGGCTTCCTCAGCACCTCCAACAGGATCAACGTCTTG
CTATCGCGTGCCAGAGACGGCATGTACATCATCGGCAACGCCAAAACGTACGAGCACGTCCCGATGTGGGCAGAA
GTCATTGCCATGCTCAAGGCATCCTCCCGCTTCGGCACGAGCCTGGAGCTGCAATGCCCTCGTCACCCCAAGGAT
CGTCTCACCGTCTCTAAGCCGGATGATTTCCTTCAGATGTCTCCCGAGAGCGGCTGCAATCTGCCGTGCGACAGG
AGGCTCGACTGCGGCCACGCGTGCACGGGCAGATGCCACTCCGACATGCTGCACCAGGCCGTCAAGTGCCTGGAG
GCCTGCCCCCGACCCAAAAAGGGCTGTAATCACCCGTGTCCGCTGCTCTGCGGAGAGGTCTGCCATGGAAGATGT
CAGGTACAGATGGAAGAGGGCGTCGAGCTCCCCTGCGGTCATCGTCATGCCCCGGCCAGTTGCTGGGAGGTGCGG
CATCCGAACTCGGTCAGGTGCAAGACCATGGTAATGCGAACGGTTCCCGGATGCCAGCACCGAGTCTTGATGCTC
TGCTACCAAGACGTGGCAAGCACATCATTCAACTGCTCATCCCCGTGCGGCCACGTCCGAGCCTGCGGACACAAA
TGCAGGAGACCTTGCTCACGCTGCAACACGCGTCAAGACGGCAAGGTGACGGAGAGGAACCATGGTATCTGCCAG
GTCAAGTGCGGCCGCAACTTCACGACGTGTCCGCACAGTTGCTCGCTTAAGTGCCACGGCGACTCGCCCTGTCCG
CCCTGCAAAGAGACTTGCCAGGCCTCGTGCGGCCACTCCCGCTGCGAAAAGGCCTGCAGCGAGCCCTGCGGGCCC
TGTGCCGAGGCGACGTGCCTTTCACGATGCCCTCACTCGCAGTGTACGATGCCGTGCGCCGCTCCTTGCAACTGG
GTGCCCTGCACGAAGCGGTGCTTGGAGCGATTGGCTTGTGGACATCAGTGCCCCTCGCTCTGCGGAGAGCAGTGT
CCCGATGAAGGATTCTGTCAGCAGTGCGGGCCACAGGAGATCAAGTCGATGCAGGTCGACGTTATCAAGATGAGG
GAGTACAAAGATATCAACCTCGATGTCGAGCCGTGCATCTTCCCCCAGTGCGGACACTTTCTCACCGTCACCTCC
ATGGACGGCCAGATGGACATGCAGGCTCACTATGAACTGGATCGAGACGGCCGCCCGACGGCCATCTCACGCCCG
TCGGAGCCTATGACGCTCGCCGGGAAGTCCATCCCAGTGTGCGGCTCATGTCGCGGCTCCCTTCGCAGCATCGCC
AGATACGGCCGCATTGTGAGACGGGCCCTACTGGATGAGGCGACCAAAAAGCTCATTACCTGGTGCGCCGACGAG
CATCTGTCTCTGGCAGAAAAGCTCGGGAGCGAGGTCGACAAGTTGGCTGAAAGACCTGTTCCTGAGACCGTTCCT
CTGTCTCACGACGATGAGGACGACAAGGACGACGACGACGACGACGACGACGACGGCGAAAAGGCAAAAGGGGCT
CTACACCACATCACGCCGCGCCTCCGACCGCTGCTGCTCCTTTCGAAGCTCGTCGGTCACCAGCGCTACGACTCA
ATCCTCGTCCTGTGGCGCACTCTGCATCAACACGCCGCCCGGGTCCGGGAAGAAGAACAGCCCTTCCAGCGGGTC
GCGGATCTTGTGCGACACGGCAACCGCTTGAAGCACACGTCGCATGAGTTCGTCTTTGACGAGTCCGTCATTCAG
CTCAAGGGCTGGCTCTCGGCTGAGACGCTGCTTCTCGAGTGTGAGCTCGTCGTGCTCGACGACTTTTCCCAGCTG
CGGAAGAAGACGCCTTGGAACCAAATCGAGGTCGAGGTCGATTTGTCGACCTGCTTCAACGCGTGTCGCTACTTG
ATCGACTTGACATCTGTTTCCAAGCATCCCAGGGAGGAGGTTAGGGGACACATCTTCGCAGCTCGCCTGAGCGGT
CTCAGTCTCGCGCTGGACTCTTACCCTCCAGTTCGCGGTGCTTTTGACCCCTTTTCCATCGTCGCGACGGCCGAG
CAGGCGAGAGCCGAGGGCCTGTATCACATCCACCGAGCACGCACCCTCGTCTCCGCACTCCCTTCAGCCGCCGAG
ATGCTCAAGCCCGCCATCGACGCGGCCGAGACGAGACTCAACCACGGCATCTACCGCCCCGTCACCGCCTCGGAG
CTCCGGTCCGTGACGAGCGCCATGGCGGCAGAGCTGCGCGGCACGGGACACTGGTACATGTGCGCCAACGGCCAC
CCCTTTACCCTCGGCGAGTGCGGCATGCCCATGGAGCGGGCGTCGTGTCCGGAGTGCGGAGCGGCTATCGGCGGC
ATTCAGCATCGTCTTTTCGAGGGTGTCAGGCGCGCGACTGAGATGGATGACTTGGTGGGGGGGTTGGAGAGATTG
GGGATGTAG
Transcript >Ophcf2|00990
ATGGCGGGAAAAGGCGATTCCCCCGATATCACGAACCAGCCGCAGCCATGCTTGCATTTTAAACGGCACGGAATC
TGCAAGTTCGGCCAGCATTGCAAATTCTCCCATGATGTCTCCGCCGACCATGGTCTGGTACAAGAGGCGGCATCT
GACTCTCCTCCTCCATCCCGACCGCTTCTCGACGGCAAATACCAGCAGTGGAAGCGCATCCTGCGACAGAGTTCC
ATCACTTCATGCCCTTCCGCGATGGCAACCACCGACTTCTTTCGGCTGGGCCTTGAGTTGATGGACAGTGACGTT
GGCGTTTCCCAGGAGGTGGTGAAGCAGTTGGCCACTGATCCCGGCCTGCTGCTCATCAATACGGTCGCCGAGAAC
AGCATTCAAGGATATCCCTCCCCCTACGTTGCAATCTGGACCTCGCAGCTGGAGCCGTTGTTCCAGCTGTTAACG
CACCCCCGTCTCATCGACTCTGCCGTACTGGAGCAGCAGGTGGCCCTCATCTACAACTACCTCCTCGGAGTAGGA
GGCGTCCGCATGACAAGAATCTTCGACTACATCGGTCGCCTGCTCAAAAGCTGGCCGACGGATCCCATGCCTGTC
GTTGAGCTGTCCCTCGCTGTTCTCTCCAAGATTCTTGACTGCAATACGACCAATATTGTCAACGAGAGCTTCTCC
ACCTTTGTTGCGCTCTTCTCCCACCAAGTGAGCAACAGTAATGAGCCGGAGCAGGCACTCTCTCGCTTGCAGGCC
AGCAAATATCTCGACTACATGCGACTCCGGCTTGACTCTGGCAACGAGATTCGGAAATTGACCTCGAGGTCGAAA
GCAAAACCGGTTCGCCAACAGTTTGTCCTGCGGAGGGAGCTCCCCGGTCACCTATCAGCCCAAGGCCCACGTCAC
GACAACGACCATGCAGAGATTCCAAAAATCAAGATTTTGCCGACGTGGGAAGAGATCATGTCTGCGAGGGCCGAA
TACTTGCCCCTTGCAGACAGCTCTCAGTGGCACGTCAAGGGCATTCACGGACGCTTAGATCGCGAGTTCCGCCTC
TTGCGCGAGGACACCGTGGGCCAGGTCAGAGACGCCGTGTTTCAAGCTCTCCAAAAGATGCGCAACCCGACAGGC
GTGGGAGAGGCGCGCGGGCTCAAGAATAGCGCGCCTACATACACCTACAGCAAACCGACGGCCATAGACGCTTAC
TTTGACAGGTTCTCCGGCTTGGAGATGACCATTCGTTGCATGCAACCTCTTGCGGCCCAGAGAATAAAGGCCACG
GATCGGGAAGCCTGGTGGATGCAGAGCAAGCGCCTTCAGGTGGGAGCCTTGGTTTGTGCCGTGAATCCAACGGGC
TCTGTTCTATTTTTCGTTGTTTCCAACTCGACCATGAGAAGTAAAGCCGATATCAAACACACTCGCCAGACGAAA
TCCACCGAGGATGATGACGCACCGGTCGAGCACCTGACCCTCTCTGACGATGCCAAGTTTCTCTTCGTCAAGCTC
CAGCTGGCTAGCACCAATGAACAAGAGGTCGCCCTGGCTTTGCGATGGTATCGAACCATAGAGTCCGGGCCTGCT
TGGTGCTTGGTCGAATTCCCCGGCATCCTCCTTGCGTCGTTCAAGTATACGCTTGAAGCCTTGCAGCGCATGTAC
CAGAAGCTGGACATTCCGTTTTGCAAGATCTTGGCGCCGTCAGAGTCCACGTCCGGCCCTGCCGTCATGGATCCT
CCGCTCTACGCCAGAGCGCCTGGCTTTGCCTTTAGCATGAGATGCCTGAGCAACGACGACAGGGAGCTGGTATCT
TCGCTTCGCGCCCCTCTTACGCCTAGCCAGCTCGCGTCCCGGTCTTGCCTTGATCCCACCCAGGCTGCGGCCCTA
TTGAACACTTTATCGCGCGAAGTCTCCCTCATCCAGGGCCCTCCTGGCACCGGCAAGAGCTACACCGGGGAGAAG
ATTATCAAAGTCTTGCTGGAGAACAGAAAGCAAGCCAAGCTGGGGCCCATTCTTTGCGTCTGCTACACCAACCAC
GCGCTGGATCAGGTGCTCGAGCACTTGCTCGATGAAGGCATCGAAAACATTATACGCATAGGCTCGCGGTCGAAA
TCCGACAGGCTGGGCAAGTTGAACCTGGTGGAGGTGGCCAAAGCATGCAGCCGGACGAAGGCAGAAAAGTACAGG
CTATATGAAGTCGAGGCGTCAGTCCGGTTTATCAAGAAGCAGGTAGACCAAGAACTCGACAAGCTCAAGACGATG
AATTCCTGGTCAACGCTGAAAGCTCACCTCTTTACGGCGAATCGTAAACACCACGACGAGTTGTTCGGCAAAAAG
AAGAAAGGCGAGCCGGGATGGACACGTGTGGTGCATTCTTCGCAAGACCGATCGCTTGAAAGGTGGTTGCATGGG
GAACTACGCGAAGAGGAGGGGCAACGACACGTCGAGGGGCAACGACATGTCGAGGAGCTCCTGGGCGCTGAGCTC
GCCAGTATGAACCACGCAGAGCGAAGGGAACTATACAATCATTGGCTTCACAACATCCGCGACGAGGCCACCACC
GTTGTCCAAAACCTATACGACGACTTTAACGAGGCGGCCGAGACGCGGGCTCGCGCGCGCCACGACGTGGATCTG
CGCTGTCTTCAGAATGCCCAGGTGGTAGGCGTCACCACGACCGGACTGGCCAGATGCTTGGACCTTCTCCGCAAG
GTCCGATGCAAAGTGGTGGTGTGCGAGGAGGCGGGAGAAGTCCTCGAAGCACACATTCTCACCGCCCTCCTCCCG
ACGGTAGAGCATGCCATCCTGATCGGCGACCATCTCCAGCTCCGGCCGCAAATTCAAAATTACGAGCTGCAGAGC
ACGAACCCGCGCGGACGCGAGTACTCTCTCGATGTCTCACTGTTTGAGCGGCTTGTGAAGCCGGACGATGGCGGC
GAGAGGCGCTTACCCCTGAGCGTGCTGGAGACGCAGAGACGTATGCACCCCGACATGGCCGAGCTCATTCGCTCG
ACGCTCTATCCGAATCTGAAGAACTCCGAGGCGGTTACGCAGCATCCGGAAGTTGTCGGCCTCCGCGAGCGGTTG
TTCTGGCTCCATCATGAGAAGCAAGAGGCGGCGGCCGCAAACTACGATGCATACGGCACATCACACCGCAACGAC
TACGAGGTCGAGATGACGGTCTCTCTGGTATCCCATCTGTTCCGGCAGGGAAAGTACTCTCATGGCGACATTGCC
GTCTTGACGCCCTACCTCAGCCAGCTCCATCAGCTGCGACGACGGATGCAAACCATGTTTGAAATTAGTGTCGGC
GACCGCGATCTCGAAGCGCTCGAAGCGGTTGAGGGCGATGGCAAGACTGTGCCACCAATTTCCAGGGCGCTGCTG
AACCGATCGACGCTCCTCAAAAGTGTCCGAGCCGCGACCGTCGACAATTTCCAGGGCGAGGAGGCCAAGGTGGTG
GTCATATCCCTGGTTCGCAGCAACCAACAGAACAGATGCGGCTTCCTCAGCACCTCCAACAGGATCAACGTCTTG
CTATCGCGTGCCAGAGACGGCATGTACATCATCGGCAACGCCAAAACGTACGAGCACGTCCCGATGTGGGCAGAA
GTCATTGCCATGCTCAAGGCATCCTCCCGCTTCGGCACGAGCCTGGAGCTGCAATGCCCTCGTCACCCCAAGGAT
CGTCTCACCGTCTCTAAGCCGGATGATTTCCTTCAGATGTCTCCCGAGAGCGGCTGCAATCTGCCGTGCGACAGG
AGGCTCGACTGCGGCCACGCGTGCACGGGCAGATGCCACTCCGACATGCTGCACCAGGCCGTCAAGTGCCTGGAG
GCCTGCCCCCGACCCAAAAAGGGCTGTAATCACCCGTGTCCGCTGCTCTGCGGAGAGGTCTGCCATGGAAGATGT
CAGGTACAGATGGAAGAGGGCGTCGAGCTCCCCTGCGGTCATCGTCATGCCCCGGCCAGTTGCTGGGAGGTGCGG
CATCCGAACTCGGTCAGGTGCAAGACCATGGTAATGCGAACGGTTCCCGGATGCCAGCACCGAGTCTTGATGCTC
TGCTACCAAGACGTGGCAAGCACATCATTCAACTGCTCATCCCCGTGCGGCCACGTCCGAGCCTGCGGACACAAA
TGCAGGAGACCTTGCTCACGCTGCAACACGCGTCAAGACGGCAAGGTGACGGAGAGGAACCATGGTATCTGCCAG
GTCAAGTGCGGCCGCAACTTCACGACGTGTCCGCACAGTTGCTCGCTTAAGTGCCACGGCGACTCGCCCTGTCCG
CCCTGCAAAGAGACTTGCCAGGCCTCGTGCGGCCACTCCCGCTGCGAAAAGGCCTGCAGCGAGCCCTGCGGGCCC
TGTGCCGAGGCGACGTGCCTTTCACGATGCCCTCACTCGCAGTGTACGATGCCGTGCGCCGCTCCTTGCAACTGG
GTGCCCTGCACGAAGCGGTGCTTGGAGCGATTGGCTTGTGGACATCAGTGCCCCTCGCTCTGCGGAGAGCAGTGT
CCCGATGAAGGATTCTGTCAGCAGTGCGGGCCACAGGAGATCAAGTCGATGCAGGTCGACGTTATCAAGATGAGG
GAGTACAAAGATATCAACCTCGATGTCGAGCCGTGCATCTTCCCCCAGTGCGGACACTTTCTCACCGTCACCTCC
ATGGACGGCCAGATGGACATGCAGGCTCACTATGAACTGGATCGAGACGGCCGCCCGACGGCCATCTCACGCCCG
TCGGAGCCTATGACGCTCGCCGGGAAGTCCATCCCAGTGTGCGGCTCATGTCGCGGCTCCCTTCGCAGCATCGCC
AGATACGGCCGCATTGTGAGACGGGCCCTACTGGATGAGGCGACCAAAAAGCTCATTACCTGGTGCGCCGACGAG
CATCTGTCTCTGGCAGAAAAGCTCGGGAGCGAGGTCGACAAGTTGGCTGAAAGACCTGTTCCTGAGACCGTTCCT
CTGTCTCACGACGATGAGGACGACAAGGACGACGACGACGACGACGACGACGACGGCGAAAAGGCAAAAGGGGCT
CTACACCACATCACGCCGCGCCTCCGACCGCTGCTGCTCCTTTCGAAGCTCGTCGGTCACCAGCGCTACGACTCA
ATCCTCGTCCTGTGGCGCACTCTGCATCAACACGCCGCCCGGGTCCGGGAAGAAGAACAGCCCTTCCAGCGGGTC
GCGGATCTTGTGCGACACGGCAACCGCTTGAAGCACACGTCGCATGAGTTCGTCTTTGACGAGTCCGTCATTCAG
CTCAAGGGCTGGCTCTCGGCTGAGACGCTGCTTCTCGAGTGTGAGCTCGTCGTGCTCGACGACTTTTCCCAGCTG
CGGAAGAAGACGCCTTGGAACCAAATCGAGGTCGAGGTCGATTTGTCGACCTGCTTCAACGCGTGTCGCTACTTG
ATCGACTTGACATCTGTTTCCAAGCATCCCAGGGAGGAGGTTAGGGGACACATCTTCGCAGCTCGCCTGAGCGGT
CTCAGTCTCGCGCTGGACTCTTACCCTCCAGTTCGCGGTGCTTTTGACCCCTTTTCCATCGTCGCGACGGCCGAG
CAGGCGAGAGCCGAGGGCCTGTATCACATCCACCGAGCACGCACCCTCGTCTCCGCACTCCCTTCAGCCGCCGAG
ATGCTCAAGCCCGCCATCGACGCGGCCGAGACGAGACTCAACCACGGCATCTACCGCCCCGTCACCGCCTCGGAG
CTCCGGTCCGTGACGAGCGCCATGGCGGCAGAGCTGCGCGGCACGGGACACTGGTACATGTGCGCCAACGGCCAC
CCCTTTACCCTCGGCGAGTGCGGCATGCCCATGGAGCGGGCGTCGTGTCCGGAGTGCGGAGCGGCTATCGGCGGC
ATTCAGCATCGTCTTTTCGAGGGTGTCAGGCGCGCGACTGAGATGGATGACTTGGTGGGGGGGTTGGAGAGATTG
GGGATGTAG
Gene >Ophcf2|00990
ATGGCGGGAAAAGGGTTGGTTTCTCGGGAGCTCGAGTCGGAAGATTCGCAGAATCTTGCTAAAAGTGCATGCTAT
GTCCCCTCACAGCGATTCCCCCGATATCACGAACCAGCCGCAGCCATGCTTGCATTTTAAACGGCACGGAATCTG
CAAGTTCGGCCAGCATTGCAAATTCTCCCATGATGTCTCCGCCGACCATGGTCTGGTACAAGAGGCGGCATCTGA
CTCTCCTCCTCCATCCCGACCGCTTCTCGACGGCAAATACCAGCAGTGGAAGCGCATCCTGCGACAGAGTTCCAT
CACTTCATGCCCTTCCGCGATGGCAACCACCGACTTCTTTCGGCTGGGCCTTGAGTTGATGGACAGTGACGTTGG
CGTTTCCCAGGAGGTGGTGAAGCAGTTGGCCACTGATCCCGGCCTGCTGCTCATCAATACGGTCGCCGAGAACAG
CATTCAAGGATATCCCTCCCCCTACGTTGCAATCTGGACCTCGCAGCTGGAGCCGTTGTTCCAGCTGTTAACGCA
CCCCCGTCTCATCGACTCTGCCGTACTGGAGCAGCAGGTGGCCCTCATCTACAACTACCTCCTCGGAGTAGGAGG
CGTCCGCATGACAAGAATCTTCGACTACATCGGTCGCCTGCTCAAAAGCTGGCCGACGGATCCCATGCCTGTCGT
TGAGCTGTCCCTCGCTGTTCTCTCCAAGATTCTTGACTGCAATACGACCAATATTGTCAACGAGAGCTTCTCCAC
CTTTGTTGCGCTCTTCTCCCACCAAGTGAGCAACAGTAATGAGCCGGAGCAGGCACTCTCTCGCTTGCAGGCCAG
CAAATATCTCGACTACATGCGACTCCGGCTTGACTCTGGCAACGAGATTCGGAAATTGACCTCGAGGTCGAAAGC
AAAACCGGTTCGCCAACAGTTTGTCCTGCGGAGGGAGCTCCCCGGTCACCTATCAGCCCAAGGCCCACGTCACGA
CAACGACCATGCAGAGATTCCAAAAATCAAGATTTTGCCGACGTGGGAAGAGATCATGTCTGCGAGGGCCGAATA
CTTGCCCCTTGCAGACAGCTCTCAGTGGCACGTCAAGGGCATTCACGGACGCTTAGATCGCGAGTTCCGCCTCTT
GCGCGAGGACACCGTGGGCCAGGTCAGAGACGCCGTGTTTCAAGCTCTCCAAAAGATGCGCAACCCGACAGGCGT
GGGAGAGGCGCGCGGGCTCAAGAATAGCGCGCCTACATACACCTACAGCAAACCGACGGCCATAGACGCTTACTT
TGACAGGTTCTCCGGCTTGGAGATGACCATTCGTTGCATGCAACCTCTTGCGGCCCAGAGAATAAAGGCCACGGA
TCGGGAAGCCTGGTGGATGCAGAGCAAGCGCCTTCAGGTGGGAGCCTTGGTTTGTGCCGTGAATCCAACGGGCTC
TGTTCTATTTTTCGTTGTTTCCAACTCGACCATGAGAAGTAAAGCCGATATCAAACACACTCGCCAGACGAAATC
CACCGAGGATGATGACGCACCGGTCGAGCACCTGACCCTCTCTGACGATGCCAAGTTTCTCTTCGTCAAGCTCCA
GCTGGCTAGCACCAATGAACAAGAGGTCGCCCTGGCTTTGCGATGGTATCGAACCATAGAGTCCGGGCCTGCTTG
GTGCTTGGTCGAATTCCCCGGCATCCTCCTTGCGTCGTTCAAGTATACGCTTGAAGCCTTGCAGCGCATGTACCA
GAAGCTGGACATTCCGTTTTGCAAGATCTTGGCGCCGTCAGAGTCCACGTCCGGCCCTGCCGTCATGGATCCTCC
GCTCTACGCCAGAGCGCCTGGCTTTGCCTTTAGCATGAGATGCCTGAGCAACGACGACAGGGAGCTGGTATCTTC
GCTTCGCGCCCCTCTTACGCCTAGCCAGCTCGCGTCCCGGTCTTGCCTTGATCCCACCCAGGCTGCGGCCCTATT
GAACACTTTATCGCGCGAAGTCTCCCTCATCCAGGGCCCTCCTGGCACCGGCAAGAGCTACACCGGGGAGAAGAT
TATCAAAGTCTTGCTGGAGAACAGAAAGCAAGCCAAGCTGGGGCCCATTCTTTGCGTCTGCTACACCAACCACGC
GCTGGATCAGGTGCTCGAGCACTTGCTCGATGAAGGCATCGAAAACATTATACGCATAGGCTCGCGGTCGAAATC
CGACAGGCTGGGCAAGTTGAACCTGGTGGAGGTGGCCAAAGCATGCAGCCGGACGAAGGCAGAAAAGTACAGGCT
ATATGAAGTCGAGGCGTCAGTCCGGTTTATCAAGAAGCAGGTAGACCAAGAACTCGACAAGCTCAAGACGATGAA
TTCCTGGTCAACGCTGAAAGCTCACCTCTTTACGGCGAATCGTAAACACCACGACGAGTTGTTCGGCAAAAAGAA
GAAAGGCGAGCCGGGATGGACACGTGTGGTGCATTCTTCGCAAGACCGATCGCTTGAAAGGTGGTTGCATGGGGA
ACTACGCGAAGAGGAGGGGCAACGACACGTCGAGGGGCAACGACATGTCGAGGAGCTCCTGGGCGCTGAGCTCGC
CAGTATGAACCACGCAGAGCGAAGGGAACTATACAATCATTGGCTTCACAACATCCGCGACGAGGCCACCACCGT
TGTCCAAAACCTATACGACGACTTTAACGAGGCGGCCGAGACGCGGGCTCGCGCGCGCCACGACGTGGATCTGCG
CTGTCTTCAGAATGCCCAGGTGGTAGGCGTCACCACGACCGGACTGGCCAGATGCTTGGACCTTCTCCGCAAGGT
CCGATGCAAAGTGGTGGTGTGCGAGGAGGCGGGAGAAGTCCTCGAAGCACACATTCTCACCGCCCTCCTCCCGAC
GGTAGAGCATGCCATCCTGATCGGCGACCATCTCCAGCTCCGGCCGCAAATTCAAAATTACGAGCTGCAGAGCAC
GAACCCGCGCGGACGCGAGTACTCTCTCGATGTCTCACTGTTTGAGCGGCTTGTGAAGCCGGACGATGGCGGCGA
GAGGCGCTTACCCCTGAGCGTGCTGGAGACGCAGAGACGTATGCACCCCGACATGGCCGAGCTCATTCGCTCGAC
GCTCTATCCGAATCTGAAGAACTCCGAGGCGGTTACGCAGCATCCGGAAGTTGTCGGCCTCCGCGAGCGGTTGTT
CTGGCTCCATCATGAGAAGCAAGAGGCGGCGGCCGCAAACTACGATGCATACGGCACATCACACCGCAACGACTA
CGAGGTCGAGATGACGGTCTCTCTGGTATCCCATCTGTTCCGGCAGGGAAAGTACTCTCATGGCGACATTGCCGT
CTTGACGCCCTACCTCAGCCAGCTCCATCAGCTGCGACGACGGATGCAAACCATGTTTGAAATTAGTGTCGGCGA
CCGCGATCTCGAAGCGCTCGAAGCGGTTGAGGGCGATGGCAAGACTGTGCCACCAATTTCCAGGGCGCTGCTGAA
CCGATCGACGCTCCTCAAAAGTGTCCGAGCCGCGACCGTCGACAATTTCCAGGGCGAGGAGGCCAAGGTGGTGGT
CATATCCCTGGTTCGCAGCAACCAACAGAACAGATGCGGCTTCCTCAGCACCTCCAACAGGATCAACGTCTTGCT
ATCGCGTGCCAGAGACGGCATGTACATCATCGGCAACGCCAAAACGTACGAGCACGTCCCGATGTGGGCAGAAGT
CATTGCCATGCTCAAGGCATCCTCCCGCTTCGGCACGAGCCTGGAGCTGCAATGCCCTCGTCACCCCAAGGATCG
TCTCACCGTCTCTAAGCCGGATGATTTCCTTCAGATGTCTCCCGAGAGCGGCTGCAATCTGCCGTGCGACAGGAG
GCTCGACTGCGGCCACGCGTGCACGGGCAGATGCCACTCCGACATGCTGCACCAGGCCGTCAAGTGCCTGGAGGC
CTGCCCCCGACCCAAAAAGGGCTGTAATCACCCGTGTCCGCTGCTCTGCGGAGAGGTCTGCCATGGAAGATGTCA
GGTACAGATGGAAGAGGGCGTCGAGCTCCCCTGCGGTCATCGTCATGCCCCGGCCAGTTGCTGGGAGGTGCGGCA
TCCGAACTCGGTCAGGTGCAAGACCATGGTAATGCGAACGGTTCCCGGATGCCAGCACCGAGTCTTGATGCTCTG
CTACCAAGACGTGGCAAGCACATCATTCAACTGCTCATCCCCGTGCGGCCACGTCCGAGCCTGCGGACACAAATG
CAGGAGACCTTGCTCACGCTGCAACACGCGTCAAGACGGCAAGGTGACGGAGAGGAACCATGGTATCTGCCAGGT
CAAGTGCGGCCGCAACTTCACGACGTGTCCGCACAGTTGCTCGCTTAAGTGCCACGGCGACTCGCCCTGTCCGCC
CTGCAAAGAGACTTGCCAGGCCTCGTGCGGCCACTCCCGCTGCGAAAAGGCCTGCAGCGAGCCCTGCGGGCCCTG
TGCCGAGGCGACGTGCCTTTCACGATGCCCTCACTCGCAGTGTACGATGCCGTGCGCCGCTCCTTGCAACTGGGT
GCCCTGCACGAAGCGGTGCTTGGAGCGATTGGCTTGTGGACATCAGTGTAAATGCTTCGATTCCTGTCATCCTGA
CTCCGACTAACAAGACATACTTTTTCAAGGCCCCTCGCTCTGCGGAGAGCAGTGTCCCGATGAAGGATTCTGTCA
GCAGTGCGGGCCACAGGAGATCAAGTCGATGCAGGTCGACGTTATCAAGATGAGGGAGTACAAAGATATCAACCT
CGATGTCGAGCCGTGCATCTTCCCCCAGTGCGGACACTTTCTCACCGTCACCTCCATGGACGGCCAGATGGACAT
GCAGGCTCACTATGAACTGGATCGAGACGGCCGCCCGACGGCCATCTCACGCCCGTCGGAGCCTATGACGCTCGC
CGGGAAGTCCATCCCAGTGTGCGGCTCATGTCGCGGCTCCCTTCGCAGCATCGCCAGATACGGCCGCATTGTGAG
ACGGGCCCTACTGGATGAGGCGACCAAAAAGCTCATTACCTGGTGCGCCGACGAGCATCTGTCTCTGGCAGAAAA
GCTCGGGAGCGAGGTCGACAAGTTGGCTGAAAGACCTGTTCCTGAGACCGTTCCTCTGTCTCACGACGATGAGGA
CGACAAGGACGACGACGACGACGACGACGACGACGGCGAAAAGGCAAAAGGGGCTCTACACCACATCACGCCGCG
CCTCCGACCGCTGCTGCTCCTTTCGAAGCTCGTCGGTCACCAGCGCTACGACTCAATCCTCGTCCTGTGGCGCAC
TCTGCATCAACACGCCGCCCGGGTCCGGGAAGAAGAACAGCCCTTCCAGCGGGTCGCGGATCTTGTGCGACACGG
CAACCGCTTGAAGCACACGTCGCATGAGTTCGTCTTTGACGAGTCCGTCATTCAGCTCAAGGGCTGGCTCTCGGC
TGAGACGCTGCTTCTCGAGTGTGAGCTCGTCGTGCTCGACGACTTTTCCCAGCTGCGGAAGAAGACGCCTTGGAA
CCAAATCGAGGTCGAGGTCGATTTGTCGACCTGCTTCAACGCGTGTCGCTACTTGATCGACTTGACATCTGTTTC
CAAGCATCCCAGGGAGGAGGTTAGGGGACACATCTTCGCAGCTCGCCTGAGCGGTCTCAGTCTCGCGCTGGACTC
TTACCCTCCAGTTCGCGGTGCTTTTGACCCCTTTTCCATCGTCGCGACGGCCGAGCAGGCGAGAGCCGAGGGCCT
GTATCACATCCACCGAGCACGCACCCTCGTCTCCGCACTCCCTTCAGCCGCCGAGATGCTCAAGCCCGCCATCGA
CGCGGCCGAGACGAGACTCAACCACGGCATCTACCGCCCCGTCACCGCCTCGGAGCTCCGGTCCGTGACGAGCGC
CATGGCGGCAGAGCTGCGCGGCACGGGACACTGGTACATGTGCGCCAACGGCCACCCCTTTACCCTCGGCGAGTG
CGGCATGCCCATGGAGCGGGCGTCGTGTCCGGAGTGCGGAGCGGCTATCGGCGGCATTCAGCATCGTCTTTTCGA
GGGTGTCAGGCGCGCGACTGAGATGGATGACTTGGTGGGGGGGTTGGAGAGATTGGGGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail