Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00989
Gene name
Locationscaffold_01:3742065..3744806
Strand+
Gene length (bp)2741
Transcript length (bp)2643
Coding sequence length (bp)2643
Protein length (aa) 881

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04768 NAT NAT, N-acetyltransferase, of N-acetylglutamate synthase 5.8E-42 316 472
PF00696 AA_kinase Amino acid kinase family 2.0E-30 83 292
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 6.5E-28 566 682

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0000166 nucleotide binding No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.171 0.1088 0.0499 0.0617 0.9242 0.0527 0.0557 0.0339 0.0605 0.0085

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1108
Ophiocordyceps australis map64 (Brazil) OphauB2|6473
Ophiocordyceps camponoti-floridani Ophcf2|00989 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|304
Ophiocordyceps kimflemingae Ophio5|4291
Ophiocordyceps subramaniannii Hirsu2|2499

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00989
MLLSAAILRAGARRAAAVRLCAVSSRLSLRTRALSTTTARNPDWPPPQDGTREIVTQMISNIGSKREVQQYLKLF
TSVSSQKFAVIKVGGAILTHHLGELCRSLLLLYKLGLYPIIVHGAGPQLNQLLEEAGVEPQFEEGIRVTDAKTLV
VARKLFLDENLRLLERLDDLGIQTRSLGGVLIADYLDKEKWQNVGKITRVNKAAIEQSIAAGYIPVLTSLAETED
GQLLNVNADVAAAELARALEPLKVVYLSEKGGLLDGDKNKISQINLDEEYGHLMSQPWCQYGTRLKIRQSKELLD
TLPRTSSVAIIHPSNLLKELFTDSGAGTLIRRGFKIQKATSLADFGDAARLKATLIRDREGFDAEATVDRWVDFL
AENPFTAYYDESMQCLAIVMPHGNGRAMSTLATLTITKPGWLTNIAENVFAAIKKDYPSLVWTVNEDDENLTWFF
DKADGSYKINGSVLFYYGCDVQSEALSPVYREFVAHGRAMLGGSNLESRLRQAAQAASGSGGGGGGSARIAQQAR
AFSSLSRKSPMVMQQRRGLATTTNPNPPLGSKNASNGTPARVGLVGARGYTGQALIELLNGHPYMDLRHVSSREL
AGQKLQGYSKRDITYEKLGPSDVGKLDREGAVDCWVMALPNGVCGQYVEAINESGNTKSVIVDLSADYRFDKSWT
YGLPELTKRCDITSSNRISNPGCYATAAQLGIAPILDHLGGEPTVFGVSGYSGAGTKPSPKNDVNALRDNLMPYS
LTGHIHEREISNHLGHPVAFIPHVASWFRGIHHTINIPLDKTMTSRDIRQIYQDRYAGEQLVKVVGEAPLVKSIM
DRHGVEIGGFAVHSSGKRVVVCASIDNLLKGAASQCLQNMNLALGYAEFEGIPIM*
Coding >Ophcf2|00989
ATGCTGCTGTCCGCCGCTATCTTGCGGGCCGGCGCTCGCCGTGCCGCGGCCGTGAGGCTCTGTGCCGTCTCGTCC
CGGCTCTCCCTCCGGACTCGGGCCCTTTCGACGACGACGGCCAGAAACCCCGACTGGCCTCCCCCTCAGGACGGG
ACGCGAGAGATTGTGACGCAGATGATTAGCAACATTGGCAGCAAGCGGGAGGTTCAGCAGTATCTCAAGCTGTTC
ACGTCGGTGTCTTCGCAAAAGTTCGCCGTCATCAAGGTCGGCGGCGCCATCCTGACTCACCATCTCGGCGAGCTG
TGTCGAAGCCTACTGCTCCTCTATAAGCTCGGTCTTTATCCCATCATCGTCCACGGCGCTGGGCCTCAGCTTAAC
CAGCTACTCGAGGAGGCTGGCGTTGAGCCTCAATTCGAAGAGGGCATCCGCGTCACCGATGCCAAGACGCTCGTC
GTCGCCCGCAAGCTCTTCCTCGACGAGAATCTGCGGCTGCTGGAACGGCTCGACGACCTCGGAATCCAGACGCGC
TCCCTCGGCGGGGTCCTCATCGCCGACTACCTCGACAAGGAAAAGTGGCAGAACGTCGGCAAGATCACGCGCGTC
AACAAGGCCGCCATCGAACAGTCCATCGCCGCCGGCTACATCCCCGTCCTGACGTCGCTGGCCGAGACGGAAGAC
GGCCAGCTGCTCAACGTCAACGCCGACGTGGCCGCGGCCGAGCTCGCCCGTGCCCTCGAACCGCTCAAGGTCGTT
TACCTGTCGGAAAAGGGCGGCCTGCTCGACGGCGACAAGAACAAGATCTCGCAGATCAACCTCGACGAGGAGTAC
GGCCATCTCATGTCGCAGCCCTGGTGCCAGTATGGCACGCGTCTCAAGATCCGCCAGAGCAAGGAACTACTCGAT
ACGCTGCCGCGCACCTCGAGCGTCGCCATCATCCACCCGAGCAACCTCCTCAAGGAGCTCTTCACCGACTCAGGC
GCCGGCACCCTGATCCGCCGCGGCTTCAAGATCCAAAAGGCCACGTCCCTGGCCGACTTCGGCGACGCGGCCCGC
CTCAAGGCGACGCTGATCCGCGACCGCGAGGGCTTCGACGCAGAGGCTACTGTCGACCGCTGGGTCGACTTCCTG
GCCGAAAACCCGTTCACAGCCTACTATGACGAATCCATGCAGTGCCTGGCCATCGTCATGCCCCATGGCAACGGC
CGCGCCATGTCGACGCTCGCCACGCTGACCATCACCAAGCCGGGCTGGCTGACCAACATTGCCGAGAACGTCTTC
GCAGCCATCAAGAAGGACTATCCAAGCCTAGTGTGGACCGTCAACGAGGACGACGAGAACCTGACGTGGTTCTTC
GACAAGGCCGACGGCAGCTACAAGATCAATGGCAGTGTCCTCTTCTACTACGGCTGCGACGTCCAGTCCGAGGCC
CTGAGCCCCGTCTACCGCGAATTCGTCGCTCACGGTCGCGCCATGCTGGGCGGTTCCAACCTCGAGTCCCGGCTC
CGGCAGGCGGCCCAGGCGGCGTCCGGCAGCGGCGGCGGCGGCGGCGGGTCGGCCCGGATCGCTCAGCAGGCCAGG
GCCTTTTCGAGTCTCTCCCGGAAGTCCCCGATGGTGATGCAGCAGCGACGCGGCCTCGCCACCACGACCAACCCT
AACCCACCGCTGGGCAGCAAGAACGCCAGCAACGGGACGCCGGCTCGCGTCGGCCTGGTGGGAGCCCGCGGATAC
ACGGGTCAGGCGCTGATCGAGCTGCTCAACGGCCACCCCTACATGGACCTTCGGCACGTGTCGTCGCGCGAGCTG
GCGGGTCAGAAGCTGCAGGGCTACTCCAAGCGCGACATCACGTACGAGAAGCTCGGCCCCAGCGACGTCGGCAAG
CTGGACCGAGAAGGCGCCGTCGACTGCTGGGTCATGGCGCTGCCCAACGGCGTGTGTGGCCAGTACGTCGAGGCC
ATCAACGAGTCGGGCAACACCAAGAGCGTCATCGTCGACCTCTCAGCCGACTACCGCTTCGACAAGTCGTGGACG
TACGGCCTCCCGGAGCTGACGAAGCGATGCGACATCACCAGCTCAAACCGCATCTCCAACCCAGGCTGCTACGCG
ACAGCCGCCCAGCTCGGCATCGCCCCTATCCTCGACCACCTCGGCGGCGAACCCACCGTCTTCGGCGTCTCGGGC
TACTCGGGCGCCGGAACGAAACCCTCGCCCAAGAACGACGTCAACGCCCTACGCGATAACCTCATGCCCTACAGC
CTGACGGGCCACATCCACGAGCGCGAGATAAGCAACCACCTCGGCCACCCCGTCGCCTTCATCCCCCACGTAGCC
TCGTGGTTCCGCGGCATCCATCACACCATCAACATCCCGCTCGACAAGACGATGACGTCTCGCGACATCCGCCAG
ATCTATCAAGATCGGTACGCGGGCGAGCAGCTCGTCAAGGTCGTCGGCGAAGCGCCCCTCGTCAAAAGCATCATG
GATCGCCACGGCGTCGAGATTGGCGGTTTCGCAGTTCATAGCAGCGGGAAGAGGGTCGTCGTCTGCGCCAGCATC
GATAATCTTCTCAAGGGCGCGGCATCGCAGTGCCTACAAAACATGAACCTCGCCCTCGGATACGCCGAGTTCGAA
GGCATCCCCATAATGTAG
Transcript >Ophcf2|00989
ATGCTGCTGTCCGCCGCTATCTTGCGGGCCGGCGCTCGCCGTGCCGCGGCCGTGAGGCTCTGTGCCGTCTCGTCC
CGGCTCTCCCTCCGGACTCGGGCCCTTTCGACGACGACGGCCAGAAACCCCGACTGGCCTCCCCCTCAGGACGGG
ACGCGAGAGATTGTGACGCAGATGATTAGCAACATTGGCAGCAAGCGGGAGGTTCAGCAGTATCTCAAGCTGTTC
ACGTCGGTGTCTTCGCAAAAGTTCGCCGTCATCAAGGTCGGCGGCGCCATCCTGACTCACCATCTCGGCGAGCTG
TGTCGAAGCCTACTGCTCCTCTATAAGCTCGGTCTTTATCCCATCATCGTCCACGGCGCTGGGCCTCAGCTTAAC
CAGCTACTCGAGGAGGCTGGCGTTGAGCCTCAATTCGAAGAGGGCATCCGCGTCACCGATGCCAAGACGCTCGTC
GTCGCCCGCAAGCTCTTCCTCGACGAGAATCTGCGGCTGCTGGAACGGCTCGACGACCTCGGAATCCAGACGCGC
TCCCTCGGCGGGGTCCTCATCGCCGACTACCTCGACAAGGAAAAGTGGCAGAACGTCGGCAAGATCACGCGCGTC
AACAAGGCCGCCATCGAACAGTCCATCGCCGCCGGCTACATCCCCGTCCTGACGTCGCTGGCCGAGACGGAAGAC
GGCCAGCTGCTCAACGTCAACGCCGACGTGGCCGCGGCCGAGCTCGCCCGTGCCCTCGAACCGCTCAAGGTCGTT
TACCTGTCGGAAAAGGGCGGCCTGCTCGACGGCGACAAGAACAAGATCTCGCAGATCAACCTCGACGAGGAGTAC
GGCCATCTCATGTCGCAGCCCTGGTGCCAGTATGGCACGCGTCTCAAGATCCGCCAGAGCAAGGAACTACTCGAT
ACGCTGCCGCGCACCTCGAGCGTCGCCATCATCCACCCGAGCAACCTCCTCAAGGAGCTCTTCACCGACTCAGGC
GCCGGCACCCTGATCCGCCGCGGCTTCAAGATCCAAAAGGCCACGTCCCTGGCCGACTTCGGCGACGCGGCCCGC
CTCAAGGCGACGCTGATCCGCGACCGCGAGGGCTTCGACGCAGAGGCTACTGTCGACCGCTGGGTCGACTTCCTG
GCCGAAAACCCGTTCACAGCCTACTATGACGAATCCATGCAGTGCCTGGCCATCGTCATGCCCCATGGCAACGGC
CGCGCCATGTCGACGCTCGCCACGCTGACCATCACCAAGCCGGGCTGGCTGACCAACATTGCCGAGAACGTCTTC
GCAGCCATCAAGAAGGACTATCCAAGCCTAGTGTGGACCGTCAACGAGGACGACGAGAACCTGACGTGGTTCTTC
GACAAGGCCGACGGCAGCTACAAGATCAATGGCAGTGTCCTCTTCTACTACGGCTGCGACGTCCAGTCCGAGGCC
CTGAGCCCCGTCTACCGCGAATTCGTCGCTCACGGTCGCGCCATGCTGGGCGGTTCCAACCTCGAGTCCCGGCTC
CGGCAGGCGGCCCAGGCGGCGTCCGGCAGCGGCGGCGGCGGCGGCGGGTCGGCCCGGATCGCTCAGCAGGCCAGG
GCCTTTTCGAGTCTCTCCCGGAAGTCCCCGATGGTGATGCAGCAGCGACGCGGCCTCGCCACCACGACCAACCCT
AACCCACCGCTGGGCAGCAAGAACGCCAGCAACGGGACGCCGGCTCGCGTCGGCCTGGTGGGAGCCCGCGGATAC
ACGGGTCAGGCGCTGATCGAGCTGCTCAACGGCCACCCCTACATGGACCTTCGGCACGTGTCGTCGCGCGAGCTG
GCGGGTCAGAAGCTGCAGGGCTACTCCAAGCGCGACATCACGTACGAGAAGCTCGGCCCCAGCGACGTCGGCAAG
CTGGACCGAGAAGGCGCCGTCGACTGCTGGGTCATGGCGCTGCCCAACGGCGTGTGTGGCCAGTACGTCGAGGCC
ATCAACGAGTCGGGCAACACCAAGAGCGTCATCGTCGACCTCTCAGCCGACTACCGCTTCGACAAGTCGTGGACG
TACGGCCTCCCGGAGCTGACGAAGCGATGCGACATCACCAGCTCAAACCGCATCTCCAACCCAGGCTGCTACGCG
ACAGCCGCCCAGCTCGGCATCGCCCCTATCCTCGACCACCTCGGCGGCGAACCCACCGTCTTCGGCGTCTCGGGC
TACTCGGGCGCCGGAACGAAACCCTCGCCCAAGAACGACGTCAACGCCCTACGCGATAACCTCATGCCCTACAGC
CTGACGGGCCACATCCACGAGCGCGAGATAAGCAACCACCTCGGCCACCCCGTCGCCTTCATCCCCCACGTAGCC
TCGTGGTTCCGCGGCATCCATCACACCATCAACATCCCGCTCGACAAGACGATGACGTCTCGCGACATCCGCCAG
ATCTATCAAGATCGGTACGCGGGCGAGCAGCTCGTCAAGGTCGTCGGCGAAGCGCCCCTCGTCAAAAGCATCATG
GATCGCCACGGCGTCGAGATTGGCGGTTTCGCAGTTCATAGCAGCGGGAAGAGGGTCGTCGTCTGCGCCAGCATC
GATAATCTTCTCAAGGGCGCGGCATCGCAGTGCCTACAAAACATGAACCTCGCCCTCGGATACGCCGAGTTCGAA
GGCATCCCCATAATGTAG
Gene >Ophcf2|00989
ATGCTGCTGTCCGCCGCTATCTTGCGGGCCGGCGCTCGCCGTGCCGCGGCCGTGAGGCTCTGTGCCGTCTCGTCC
CGGCTCTCCCTCCGGACTCGGGCCCTTTCGACGACGACGGCCAGAAACCCCGACTGGCCTCCCCCTCAGGACGGG
ACGCGAGAGATTGTGACGCAGATGATTAGCAACATTGGCAGCAAGCGGGAGGTTCAGCAGTATCTCAAGCTGTTC
ACGTCGGTGTCTTCGCAAAAGTTCGCCGTCATCAAGGTCGGCGGCGCCATCCTGACTCACCATCTCGGCGAGCTG
TGTCGAAGCCTACTGCTCCTCTATAAGCTCGGTCTTTATCCCATCATCGTCCACGGCGCTGGGCCTCAGCTTAAC
CAGCTACTCGAGGAGGCTGGCGTTGAGCCTCAATTCGAAGAGGGCATCCGCGTCACCGATGCCAAGACGCTCGTC
GTCGCCCGCAAGCTCTTCCTCGACGAGAATCTGCGGCTGCTGGAACGGCTCGACGACCTCGGAATCCAGACGCGC
TCCCTCGGCGGGGTCCTCATCGCCGACTACCTCGACAAGGAAAAGTGGCAGAACGTCGGCAAGATCACGCGCGTC
AACAAGGCCGCCATCGAACAGTCCATCGCCGCCGGCTACATCCCCGTCCTGACGTCGCTGGCCGAGACGGAAGAC
GGCCAGCTGCTCAACGTCAACGCCGACGTGGCCGCGGCCGAGCTCGCCCGTGCCCTCGAACCGCTCAAGGTCGTT
TACCTGTCGGAAAAGGGCGGCCTGCTCGACGGCGACAAGAACAAGATCTCGCAGATCAACCTCGACGAGGAGTAC
GGCCATCTCATGTCGCAGCCCTGGTGCCAGTATGGCACGCGTCTCAAGATCCGCCAGAGCAAGGAACTACTCGAT
ACGCTGCCGCGCACCTCGAGCGTCGCCATCATCCACCCGAGCAACCTCCTCAAGGAGCTCTTCACCGACTCAGGC
GCCGGCACCCTGATCCGCCGCGGCTTCAAGATCCAAAAGGCCACGTCCCTGGCCGACTTCGGCGACGCGGCCCGC
CTCAAGGCGACGCTGATCCGCGACCGCGAGGGCTTCGACGCAGAGGCTACTGTCGACCGCTGGGTCGACTTCCTG
GCCGAAAACCCGTTCACAGCCTACTATGACGAATCCATGCAGTGCCTGGCCATCGTCATGCCCCATGGCAACGGC
CGCGCCATGTCGACGCTCGCCACGCTGACCATCACCAAGCCGGGCTGGCTGACCAACATTGCCGAGAACGTCTTC
GCAGCCATCAAGAAGGACTATCCAAGCCTAGTGTGGACCGTCAACGAGGACGACGAGAACCTGACGTGGTTCTTC
GACAAGGCCGACGGCAGCTACAAGATCAATGGCAGTGTCCTCTTCTACTACGGCTGCGACGTCCAGTCCGAGGCC
CTGAGCCCCGTCTACCGCGAATTCGTCGCTCACGGTCGCGCCATGCTGGGCGGTTCCAACCTCGAGTCCCGGCTC
CGGCAGGCGGCCCAGGCGGCGTCCGGCAGCGGCGGCGGCGGCGGCGGGTCGGCCCGGATCGCTCAGCAGGCCAGG
GCCTTTTCGAGTCTCTCCCGGAAGTCCCCGATGGTGATGCAGCAGCGACGCGGCCTCGCCACCACGACCAACCCT
AACCCACCGCTGGGCAGCAAGAACGCCAGCAACGGGACGCCGGCTCGCGTCGGCCTGGTGGGAGCCCGCGGATAC
ACGGGTCAGGCGCTGATCGAGCTGCTCAACGGCCACCCCTACATGGACCTTCGGCACGTGTCGTCGCGCGAGCTG
GCGGGTCAGAAGCTGCAGGGCTACTCCAAGCGCGACATCACGTACGAGAAGCTCGGCCCCAGCGACGTCGGCAAG
CTGGACCGAGAAGGCGCCGTCGACTGCTGGGTCATGGCGCTGCCCAACGGCGTGTGTGGCCAGTACGTCGAGGCC
ATCAACGAGTCGGGCAACACCAAGAGCGTCATCGTCGACCTCTCAGCCGACTACCGCTTCGACAAGTCGTGGACG
TACGGCCTCCCGGAGCTGACGAAGCGATGCGACATCACCAGCTCAAACCGCATCTCCAACCCAGGCTGCTACGCG
ACAGCCGCCCAGCTCGGCATCGCCCCTATCCTCGACCACCTCGGCGGCGAACCCACCGTCTTCGGCGTCTCGGGC
TACTCGGGCGCCGGAACGAAACCCTCGCCCAAGAACGACGTCAACGCCCTACGCGATAACCTCATGCCCTACAGC
CTGACGGGCCACATCCACGAGCGCGAGATAAGCAACCACCTCGGCCACCCCGTCGCCTTCATCCCCCACGTAGCC
TCGTGGTTCCGCGGCATCCATCACACCATCAACATCCCGCTCGACAAGACGATGACGTCTCGCGACATCCGCCAG
ATCTATCAAGATCGGTACGCGGGCGAGCAGCTCGTCAAGGTCGTCGGCGAAGCGCCCCTCGTCAAAAGCATCATG
GATCGCCACGGCGTCGAGATTGGCGGTTTCGCAGTTCATAGCAGCGGGAAGAGGGTCGTCGTCTGCGCCAGCATC
GATAATCTTCTCAAGGGCGCGGCATCGCAGTGCCTACGTGAGTTTTCCTCGTCCTCTCTTCCTCCCTTGCCCCCT
TCCACTCTCGTGGATATATCCCCCGTTCACCATCACCCCCTTCACTAACACCCAACGCAGAAAACATGAACCTCG
CCCTCGGATACGCCGAGTTCGAAGGCATCCCCATAATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail