Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00984
Gene name
Locationscaffold_01:3727837..3731184
Strand-
Gene length (bp)3347
Transcript length (bp)3102
Coding sequence length (bp)3102
Protein length (aa) 1034

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08644 SPT16 FACT complex subunit (SPT16/CDC68) 2.6E-55 547 697
PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain 1.1E-53 6 166
PF00557 Peptidase_M24 Metallopeptidase family M24 4.3E-26 182 422
PF08512 Rtt106 Histone chaperone Rttp106-like 5.7E-16 824 910

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2467 0.9114 0.1364 0.0235 0.1562 0.0036 0.0995 0.0244 0.0423 0.011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup941
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2964
Ophiocordyceps australis 1348a (Ghana) OphauG2|7336
Ophiocordyceps australis map64 (Brazil) OphauB2|5395
Ophiocordyceps camponoti-floridani Ophcf2|00984 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1322
Ophiocordyceps kimflemingae Ophio5|4766
Ophiocordyceps subramaniannii Hirsu2|6825

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00984
MPEIKIDSKLFQERISHFATAWKNDLRSKDGLFGGATSIVVMMGKVEEIPELHKNNALHFWLLGYEFPTTLMLFT
VDTLFILTTQKKVKHLDQLKGGRFPIQVLVRGKDAAENEKLFISIADKIKEAGDKVGIIGKDTCKGPFVDEWKKV
WSEQCKDVEEVDISPALSMHAFSVKDENELRAMRTASKACVALMTPYFLDEMSNILDAEKKVTHATLAERVDKKL
DDEKFWQTVQLPSKGKLPSDFDAAQLDWILGPSIQSGGKYDLRFAADPNNDNLHAGIIIAALGLRYKSYCSTIAR
TYLVDPNKSQESNYKLLYMIHNTILKEIRDGMAAKDVYAKAVGIVRSKKPDMEKHFLKNVGWGVGLEKKDPTLIL
NAKNTRTLKDGMTLVIQTGFQDMENPQPQDKSSKVYSLVLTDTVRVTNSEPVVFTAEAPTSADANSFFFKDDEEA
EPTPKKEKKDSRVGAVATKNITSTRLRSERATQVDEDAEKKRREHQKELAAKKQKEGLARFAEATGGQNGGEVKK
FKRFDSYKRDDQFPSKIKNLEVVVDTKNNTVVVPIMGRPVPFHINTIKNASKSDENDFAFLRINFLSPGQGVGRK
DDQPFEDASAHFVRSLTFRSTDGDRYSEIASQISNMKRDAVKREQEKKDMEDVVEQDKLTEIRNRRPAVLDNVYI
RPAMEGKRVPGKVEIHQNGIRYQSPLNAQHRVDVLFSNVRHLFFQPCQHEMIVIIHIHLKTPIIVGNKKKTKDVQ
FYREAIDIQFDETGNRKRKYRYGDEDEFEAEQEERRRRADLDRLFQGFAQKIAEAGRNEGIEVDMPIRDLGFHGV
PFRSNVFVQPTTDCLIQVVEPPFMVLTIEDVELAHLERVQFGLKNFDMVFVFKDFARAPYHINTIPVEFLDQVKD
FLDSSDIAYTEGPLNLNWAAIMKTVTADTHQFFADGGWVFLQPDSDESGAEQESDEESAFEMDDDELDEVSESSE
EGSDFGSNASDDDDDDDAELDSDDEGEDWDQLEKKAKKRDRESGLDDEDRASKKKRRR*
Coding >Ophcf2|00984
ATGCCCGAGATCAAGATCGACAGCAAGCTCTTCCAGGAGCGCATCTCGCACTTTGCGACTGCCTGGAAGAATGAC
CTGCGCTCCAAGGATGGTCTCTTCGGCGGAGCGACTTCCATCGTCGTCATGATGGGCAAGGTCGAGGAGATTCCT
GAGCTGCACAAGAACAACGCGTTGCACTTTTGGCTGCTTGGTTACGAGTTTCCCACGACGCTGATGCTGTTCACG
GTCGACACCTTGTTCATCCTCACGACGCAGAAGAAAGTCAAGCATCTCGACCAGCTCAAAGGCGGCCGTTTTCCC
ATCCAGGTCCTCGTCCGAGGTAAGGATGCTGCCGAGAACGAGAAGCTCTTCATCAGCATCGCCGACAAGATCAAG
GAGGCTGGAGACAAAGTCGGCATCATCGGCAAAGACACCTGCAAAGGGCCCTTTGTCGACGAGTGGAAAAAGGTC
TGGAGTGAGCAGTGCAAGGACGTCGAAGAAGTCGACATCTCCCCGGCGCTCTCCATGCACGCCTTCTCCGTCAAG
GACGAAAACGAACTCCGAGCGATGCGAACGGCGTCCAAGGCTTGCGTCGCTCTCATGACGCCATACTTCCTCGAC
GAAATGTCCAACATACTGGATGCCGAGAAGAAGGTGACTCATGCCACACTCGCAGAGCGCGTCGACAAGAAGCTC
GACGACGAAAAGTTCTGGCAAACGGTTCAGCTGCCCAGCAAAGGCAAGCTGCCCAGTGATTTCGATGCCGCCCAG
CTCGACTGGATTCTCGGTCCCTCCATCCAGAGTGGCGGCAAATACGATCTCAGATTCGCAGCCGACCCTAACAAC
GACAACCTTCATGCCGGCATCATCATCGCCGCCCTCGGCCTTCGTTACAAGTCTTACTGCTCTACCATCGCCCGC
ACCTACCTCGTGGACCCCAACAAGTCGCAAGAGAGCAACTACAAGCTGCTTTACATGATCCACAACACCATCCTC
AAGGAGATTCGCGACGGCATGGCGGCCAAAGACGTGTATGCCAAGGCTGTCGGGATCGTCAGGAGCAAGAAGCCG
GACATGGAGAAGCACTTTCTCAAGAATGTCGGCTGGGGCGTCGGACTGGAAAAGAAGGACCCGACGCTCATCCTC
AACGCAAAGAACACGCGGACGCTCAAGGACGGAATGACGCTCGTCATCCAGACGGGCTTCCAGGACATGGAGAAC
CCGCAGCCTCAGGACAAGAGCAGCAAGGTCTACTCGCTCGTCCTCACCGACACGGTCCGCGTGACCAACAGCGAG
CCCGTCGTCTTCACTGCCGAGGCGCCGACCAGCGCCGACGCCAATTCCTTCTTCTTTAAGGACGACGAAGAAGCG
GAGCCGACGCCCAAGAAGGAGAAGAAGGACTCTCGAGTCGGCGCCGTGGCCACCAAGAACATCACGAGCACCCGG
CTTCGGTCCGAGCGGGCCACGCAGGTGGACGAGGACGCCGAGAAGAAGCGACGCGAGCACCAAAAGGAGCTCGCG
GCGAAGAAGCAAAAGGAGGGACTCGCCAGGTTCGCCGAGGCGACGGGAGGCCAGAACGGAGGCGAGGTGAAGAAG
TTTAAGCGGTTCGACTCGTACAAACGCGACGACCAGTTCCCGTCCAAGATCAAGAACCTCGAGGTCGTCGTCGAC
ACCAAGAACAACACCGTCGTGGTGCCCATCATGGGCAGACCCGTGCCCTTTCACATCAACACCATCAAGAATGCC
AGCAAAAGCGACGAGAACGACTTTGCCTTTTTGCGCATCAACTTCCTCTCGCCCGGTCAAGGCGTCGGCAGGAAG
GATGATCAGCCGTTCGAGGACGCGTCCGCCCACTTCGTGCGCAGTCTGACCTTTCGGTCTACAGACGGCGACAGA
TATAGTGAGATAGCGTCTCAAATATCTAACATGAAGCGCGACGCAGTCAAGAGAGAACAGGAGAAGAAGGACATG
GAGGATGTCGTCGAGCAAGACAAGCTCACCGAGATTCGCAACCGACGCCCGGCCGTTTTGGATAATGTCTATATC
CGGCCGGCCATGGAGGGAAAGCGAGTGCCCGGAAAGGTCGAGATCCATCAGAATGGTATCCGATATCAGTCTCCG
CTCAACGCGCAGCACCGCGTCGACGTGCTCTTCTCCAACGTCCGTCACCTCTTCTTCCAGCCGTGCCAGCACGAG
ATGATTGTCATCATCCACATCCACCTCAAGACCCCCATCATCGTGGGCAACAAGAAGAAGACCAAGGACGTGCAG
TTCTACCGGGAGGCTATTGACATCCAGTTCGACGAGACGGGCAATCGGAAGCGCAAATATCGGTACGGCGACGAG
GACGAGTTCGAGGCCGAGCAGGAGGAGAGGCGCCGTCGGGCCGACCTCGACCGCCTCTTCCAGGGCTTCGCGCAG
AAGATTGCCGAGGCCGGACGCAACGAGGGCATCGAGGTCGACATGCCGATCCGCGACCTCGGCTTCCACGGCGTC
CCCTTCCGGTCCAACGTCTTCGTTCAGCCGACGACGGACTGCCTGATCCAGGTGGTTGAGCCGCCCTTCATGGTG
CTGACCATTGAGGACGTCGAGCTGGCTCACCTGGAGCGTGTCCAGTTCGGTCTCAAGAATTTCGACATGGTCTTT
GTCTTCAAGGACTTTGCCCGGGCGCCGTATCACATCAACACGATCCCCGTCGAGTTCCTCGACCAGGTCAAGGAC
TTTCTCGACTCGTCCGACATCGCCTACACCGAGGGACCCCTCAACCTCAACTGGGCGGCCATCATGAAGACAGTG
ACGGCCGACACGCACCAGTTCTTCGCCGACGGCGGCTGGGTCTTCCTGCAGCCCGATTCGGACGAGTCCGGCGCC
GAGCAGGAATCGGACGAGGAGTCTGCCTTTGAGATGGACGACGACGAGCTCGACGAGGTCAGCGAGTCGAGCGAG
GAAGGGTCCGACTTTGGCAGCAACGCCAGCGACGATGACGACGACGACGACGCTGAGCTCGACTCGGACGACGAG
GGCGAGGACTGGGACCAGCTCGAGAAGAAGGCCAAGAAGCGCGATCGCGAGAGCGGGCTGGACGACGAGGACCGC
GCCAGCAAGAAGAAGCGGAGACGCTGA
Transcript >Ophcf2|00984
ATGCCCGAGATCAAGATCGACAGCAAGCTCTTCCAGGAGCGCATCTCGCACTTTGCGACTGCCTGGAAGAATGAC
CTGCGCTCCAAGGATGGTCTCTTCGGCGGAGCGACTTCCATCGTCGTCATGATGGGCAAGGTCGAGGAGATTCCT
GAGCTGCACAAGAACAACGCGTTGCACTTTTGGCTGCTTGGTTACGAGTTTCCCACGACGCTGATGCTGTTCACG
GTCGACACCTTGTTCATCCTCACGACGCAGAAGAAAGTCAAGCATCTCGACCAGCTCAAAGGCGGCCGTTTTCCC
ATCCAGGTCCTCGTCCGAGGTAAGGATGCTGCCGAGAACGAGAAGCTCTTCATCAGCATCGCCGACAAGATCAAG
GAGGCTGGAGACAAAGTCGGCATCATCGGCAAAGACACCTGCAAAGGGCCCTTTGTCGACGAGTGGAAAAAGGTC
TGGAGTGAGCAGTGCAAGGACGTCGAAGAAGTCGACATCTCCCCGGCGCTCTCCATGCACGCCTTCTCCGTCAAG
GACGAAAACGAACTCCGAGCGATGCGAACGGCGTCCAAGGCTTGCGTCGCTCTCATGACGCCATACTTCCTCGAC
GAAATGTCCAACATACTGGATGCCGAGAAGAAGGTGACTCATGCCACACTCGCAGAGCGCGTCGACAAGAAGCTC
GACGACGAAAAGTTCTGGCAAACGGTTCAGCTGCCCAGCAAAGGCAAGCTGCCCAGTGATTTCGATGCCGCCCAG
CTCGACTGGATTCTCGGTCCCTCCATCCAGAGTGGCGGCAAATACGATCTCAGATTCGCAGCCGACCCTAACAAC
GACAACCTTCATGCCGGCATCATCATCGCCGCCCTCGGCCTTCGTTACAAGTCTTACTGCTCTACCATCGCCCGC
ACCTACCTCGTGGACCCCAACAAGTCGCAAGAGAGCAACTACAAGCTGCTTTACATGATCCACAACACCATCCTC
AAGGAGATTCGCGACGGCATGGCGGCCAAAGACGTGTATGCCAAGGCTGTCGGGATCGTCAGGAGCAAGAAGCCG
GACATGGAGAAGCACTTTCTCAAGAATGTCGGCTGGGGCGTCGGACTGGAAAAGAAGGACCCGACGCTCATCCTC
AACGCAAAGAACACGCGGACGCTCAAGGACGGAATGACGCTCGTCATCCAGACGGGCTTCCAGGACATGGAGAAC
CCGCAGCCTCAGGACAAGAGCAGCAAGGTCTACTCGCTCGTCCTCACCGACACGGTCCGCGTGACCAACAGCGAG
CCCGTCGTCTTCACTGCCGAGGCGCCGACCAGCGCCGACGCCAATTCCTTCTTCTTTAAGGACGACGAAGAAGCG
GAGCCGACGCCCAAGAAGGAGAAGAAGGACTCTCGAGTCGGCGCCGTGGCCACCAAGAACATCACGAGCACCCGG
CTTCGGTCCGAGCGGGCCACGCAGGTGGACGAGGACGCCGAGAAGAAGCGACGCGAGCACCAAAAGGAGCTCGCG
GCGAAGAAGCAAAAGGAGGGACTCGCCAGGTTCGCCGAGGCGACGGGAGGCCAGAACGGAGGCGAGGTGAAGAAG
TTTAAGCGGTTCGACTCGTACAAACGCGACGACCAGTTCCCGTCCAAGATCAAGAACCTCGAGGTCGTCGTCGAC
ACCAAGAACAACACCGTCGTGGTGCCCATCATGGGCAGACCCGTGCCCTTTCACATCAACACCATCAAGAATGCC
AGCAAAAGCGACGAGAACGACTTTGCCTTTTTGCGCATCAACTTCCTCTCGCCCGGTCAAGGCGTCGGCAGGAAG
GATGATCAGCCGTTCGAGGACGCGTCCGCCCACTTCGTGCGCAGTCTGACCTTTCGGTCTACAGACGGCGACAGA
TATAGTGAGATAGCGTCTCAAATATCTAACATGAAGCGCGACGCAGTCAAGAGAGAACAGGAGAAGAAGGACATG
GAGGATGTCGTCGAGCAAGACAAGCTCACCGAGATTCGCAACCGACGCCCGGCCGTTTTGGATAATGTCTATATC
CGGCCGGCCATGGAGGGAAAGCGAGTGCCCGGAAAGGTCGAGATCCATCAGAATGGTATCCGATATCAGTCTCCG
CTCAACGCGCAGCACCGCGTCGACGTGCTCTTCTCCAACGTCCGTCACCTCTTCTTCCAGCCGTGCCAGCACGAG
ATGATTGTCATCATCCACATCCACCTCAAGACCCCCATCATCGTGGGCAACAAGAAGAAGACCAAGGACGTGCAG
TTCTACCGGGAGGCTATTGACATCCAGTTCGACGAGACGGGCAATCGGAAGCGCAAATATCGGTACGGCGACGAG
GACGAGTTCGAGGCCGAGCAGGAGGAGAGGCGCCGTCGGGCCGACCTCGACCGCCTCTTCCAGGGCTTCGCGCAG
AAGATTGCCGAGGCCGGACGCAACGAGGGCATCGAGGTCGACATGCCGATCCGCGACCTCGGCTTCCACGGCGTC
CCCTTCCGGTCCAACGTCTTCGTTCAGCCGACGACGGACTGCCTGATCCAGGTGGTTGAGCCGCCCTTCATGGTG
CTGACCATTGAGGACGTCGAGCTGGCTCACCTGGAGCGTGTCCAGTTCGGTCTCAAGAATTTCGACATGGTCTTT
GTCTTCAAGGACTTTGCCCGGGCGCCGTATCACATCAACACGATCCCCGTCGAGTTCCTCGACCAGGTCAAGGAC
TTTCTCGACTCGTCCGACATCGCCTACACCGAGGGACCCCTCAACCTCAACTGGGCGGCCATCATGAAGACAGTG
ACGGCCGACACGCACCAGTTCTTCGCCGACGGCGGCTGGGTCTTCCTGCAGCCCGATTCGGACGAGTCCGGCGCC
GAGCAGGAATCGGACGAGGAGTCTGCCTTTGAGATGGACGACGACGAGCTCGACGAGGTCAGCGAGTCGAGCGAG
GAAGGGTCCGACTTTGGCAGCAACGCCAGCGACGATGACGACGACGACGACGCTGAGCTCGACTCGGACGACGAG
GGCGAGGACTGGGACCAGCTCGAGAAGAAGGCCAAGAAGCGCGATCGCGAGAGCGGGCTGGACGACGAGGACCGC
GCCAGCAAGAAGAAGCGGAGACGCTGA
Gene >Ophcf2|00984
ATGCCCGAGATCAAGATCGACAGCAAGCTCTTCCAGGAGCGCATCTCGCACTTTGCGACTGCCTGGAAGAATGAC
CTGCGCTCCAAGGATGGTCTCTTCGGCGGAGCGACTTCCATCGTCGTCATGATGGGCAAGGTCGAGGAGATTCCT
GAGCTGCACAAGAACAACGCGTTGCACGTGAGAAGATACCCATCGCCTTGCCTTGCTTTCCTTCCCCTGCCGGTT
GACGACATGCTGACCGTATCTGTTGCAGTTTTGGCTGCTTGGTTACGAGTTTCCCACGACGCTGATGCTGTTCAC
GGTCGACACCTTGTTCATCCTCACGACGCAGAAGAAAGGTCTGTTGAATCCGCACCCATCAAAGGCCCTGGAATC
CTGCTGATCCTTCTGCAGTCAAGCATCTCGACCAGCTCAAAGGCGGCCGTTTTCCCATCCAGGTCCTCGTCCGAG
GTAAGGATGCTGCCGAGAACGAGAAGCTCTTCATCAGCATCGCCGACAAGATCAAGGAGGCTGGAGTGAGTGCCG
CGCACTGCGCCGACGATTGACTTCCCCTGCTGACTCTCGCACGTACAGGACAAAGTCGGCATCATCGGCAAAGAC
ACCTGCAAAGGGCCCTTTGTCGACGAGTGGAAAAAGGTCTGGAGTGAGCAGTGCAAGGACGTCGAAGAAGTCGAC
ATCTCCCCGGCGCTCTCCATGCACGCCTTCTCCGTCAAGGACGAAAACGAACTCCGAGCGATGCGAACGGCGTCC
AAGGCTTGCGTCGCTCTCATGACGCCATACTTCCTCGACGAAATGTCCAACATACTGGATGCCGAGAAGAAGGTG
ACTCATGCCACACTCGCAGAGCGCGTCGACAAGAAGCTCGACGACGAAAAGTTCTGGCAAACGGTTCAGCTGCCC
AGCAAAGGCAAGCTGCCCAGTGATTTCGATGCCGCCCAGCTCGACTGGATTCTCGGTCCCTCCATCCAGAGTGGC
GGCAAATACGATCTCAGATTCGCAGCCGACCCTAACAACGACAACCTTCATGCCGGCATCATCATCGCCGCCCTC
GGCCTTCGTTACAAGTCTTACTGCTCTACCATCGCCCGCACCTACCTCGTGGACCCCAACAAGTCGCAAGAGAGC
AACTACAAGCTGCTTTACATGATCCACAACACCATCCTCAAGGAGATTCGCGACGGCATGGCGGCCAAAGACGTG
TATGCCAAGGCTGTCGGGATCGTCAGGAGCAAGAAGCCGGACATGGAGAAGCACTTTCTCAAGAATGTCGGCTGG
GGCGTCGGACTGGAAAAGAAGGACCCGACGCTCATCCTCAACGCAAAGAACACGCGGACGCTCAAGGACGGAATG
ACGCTCGTCATCCAGACGGGCTTCCAGGACATGGAGAACCCGCAGCCTCAGGACAAGAGCAGCAAGGTCTACTCG
CTCGTCCTCACCGACACGGTCCGCGTGACCAACAGCGAGCCCGTCGTCTTCACTGCCGAGGCGCCGACCAGCGCC
GACGCCAATTCCTTCTTCTTTAAGGACGACGAAGAAGCGGAGCCGACGCCCAAGAAGGAGAAGAAGGACTCTCGA
GTCGGCGCCGTGGCCACCAAGAACATCACGAGCACCCGGCTTCGGTCCGAGCGGGCCACGCAGGTGGACGAGGAC
GCCGAGAAGAAGCGACGCGAGCACCAAAAGGAGCTCGCGGCGAAGAAGCAAAAGGAGGGACTCGCCAGGTTCGCC
GAGGCGACGGGAGGCCAGAACGGAGGCGAGGTGAAGAAGTTTAAGCGGTTCGACTCGTACAAACGCGACGACCAG
TTCCCGTCCAAGATCAAGAACCTCGAGGTCGTCGTCGACACCAAGAACAACACCGTCGTGGTGCCCATCATGGGC
AGACCCGTGCCCTTTCACATCAACACCATCAAGAATGCCAGCAAAAGCGACGAGAACGACTTTGCCTTTTTGCGC
ATCAACTTCCTCTCGCCCGGTCAAGGCGTCGGCAGGAAGGATGATCAGCCGTTCGAGGACGCGTCCGCCCACTTC
GTGCGCAGTCTGACCTTTCGGTCTACAGACGGCGACAGATATAGTGAGATAGCGTCTCAAATATCTAACATGAAG
CGCGACGCAGTCAAGAGAGAACAGGAGAAGAAGGACATGGAGGATGTCGTCGAGCAAGACAAGCTCACCGAGATT
CGCAGTAAGCCGGTAACCACTAAGGGGGCAATGGCCAAAGACTGACAGAGGGAATCGCAGACCGACGCCCGGCCG
TTTTGGATAATGTCTATATCCGGCCGGCCATGGAGGGAAAGCGAGTGCCCGGAAAGGTCGAGATCCATCAGAATG
GTATCCGATATCAGTCTCCGCTCAACGCGCAGCACCGCGTCGACGTGCTCTTCTCCAACGTCCGTCACCTCTTCT
TCCAGCCGTGCCAGCACGAGATGATTGTCATCATCCACATCCACCTCAAGACCCCCATCATCGTGGGCAACAAGA
AGAAGACCAAGGACGTGCAGTTCTACCGGGAGGCTATTGACATCCAGTTCGACGAGACGGGCAATCGGAAGCGCA
AATATCGGTACGGCGACGAGGACGAGTTCGAGGCCGAGCAGGAGGAGAGGCGCCGTCGGGCCGACCTCGACCGCC
TCTTCCAGGGCTTCGCGCAGAAGATTGCCGAGGCCGGACGCAACGAGGGCATCGAGGTCGACATGCCGATCCGCG
ACCTCGGCTTCCACGGCGTCCCCTTCCGGTCCAACGTCTTCGTTCAGCCGACGACGGACTGCCTGATCCAGGTGG
TTGAGCCGCCCTTCATGGTGCTGACCATTGAGGACGTCGAGCTGGCTCACCTGGAGCGTGTCCAGTTCGGTCTCA
AGAATTTCGACATGGTCTTTGTCTTCAAGGACTTTGCCCGGGCGCCGTATCACATCAACACGATCCCCGTCGAGT
TCCTCGACCAGGTCAAGGACTTTCTCGACTCGTCCGACATCGCCTACACCGAGGGACCCCTCAACCTCAACTGGG
CGGCCATCATGAAGACAGTGACGGCCGACACGCACCAGTTCTTCGCCGACGGCGGCTGGGTCTTCCTGCAGCCCG
ATTCGGACGAGTCCGGCGCCGAGCAGGAATCGGACGAGGAGTCTGCCTTTGAGATGGACGACGACGAGCTCGACG
AGGTCAGCGAGTCGAGCGAGGAAGGGTCCGACTTTGGCAGCAACGCCAGCGACGATGACGACGACGACGACGCTG
AGCTCGACTCGGACGACGAGGGCGAGGACTGGGACCAGCTCGAGAAGAAGGCCAAGAAGCGCGATCGCGAGAGCG
GGCTGGACGACGAGGACCGCGCCAGCAAGAAGAAGCGGAGACGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail