Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00983
Gene name
Locationscaffold_01:3725490..3727001
Strand+
Gene length (bp)1511
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03381 CDC50 LEM3 (ligand-effect modulator 3) family / CDC50 family 3.2E-99 72 388

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 359 381 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 76.70 44.11 109.30
Alive In ants, during behavior modification 90.00 51.66 128.33
Dead In ants, recently dead 104.81 59.43 150.20

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.426446 no
Alive Dead 0.381835 no
Dead Fungus 0.099481 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00983
MSDSPPDAGQADSINSHESSPKHSEKKKSRRPANTAFRQQRLKAWQPILTPKTVLPLFFTIGIIFAPIGGLLLYA
SAKVQEIIIDYSKCIQEAQQGVFTEIPSDRVYAAFKSSNRTIDAKWSRTDNVEVFVENTGVRIQTQQCILEFEIP
DRMKPPVLFYYKLTNFHQNHRRYVESFDQDQLKGEAVPFDKIKTSKCNPLYGEDDKPYYPCGLIANSIFNDTFSS
PVMLNPPGAIGNQTRTYDMTQEGIAWSSDKALYGKTTYQFDQILPPPNWQKRYPDGYTDKNPPPDLKTDEVFQNW
MRTAALPSFSKLYQRNDTASMDKGRYRVTINDYFPTSEYKGTKSVVITTRTVMGGRNPFLGIAYLVVGGLCILLG
TVFTATHLIKPRKLGDHTYLSWNKVPTAPRSAGASAAIASGREIRPSEA*
Coding >Ophcf2|00983
ATGTCCGACTCGCCTCCGGACGCCGGCCAAGCCGACTCCATCAACTCGCACGAGTCAAGTCCCAAGCACTCGGAG
AAGAAGAAGAGCCGGCGGCCAGCGAATACCGCTTTTCGTCAGCAGCGTCTCAAGGCTTGGCAGCCCATCCTGACG
CCCAAGACGGTGCTACCTTTGTTCTTCACCATCGGCATCATATTCGCTCCTATCGGCGGCCTGCTTCTCTACGCC
AGCGCCAAGGTCCAGGAGATCATCATCGATTACTCAAAGTGCATACAAGAAGCACAGCAAGGTGTCTTCACCGAG
ATTCCCAGCGATAGGGTATACGCCGCCTTCAAGAGCAGCAACAGAACCATCGACGCCAAATGGTCTCGAACCGAC
AACGTCGAAGTCTTTGTGGAAAACACGGGCGTCAGGATTCAGACCCAACAATGCATCCTCGAATTCGAGATTCCC
GACAGGATGAAACCGCCCGTTCTATTCTACTACAAGCTCACAAACTTCCACCAGAACCATCGTCGCTACGTTGAA
TCGTTCGATCAGGATCAGCTCAAAGGAGAGGCTGTCCCATTCGACAAGATCAAGACGTCCAAGTGCAATCCGCTC
TACGGCGAAGACGATAAACCATACTATCCCTGCGGACTCATCGCCAACTCCATCTTCAACGATACCTTTAGCTCG
CCCGTCATGCTCAACCCCCCCGGAGCTATAGGCAACCAGACTCGCACCTATGACATGACGCAAGAGGGCATCGCC
TGGAGCAGCGACAAGGCCCTCTACGGCAAGACGACGTACCAATTCGACCAGATCCTTCCTCCACCGAACTGGCAG
AAGCGATATCCGGATGGCTACACGGATAAGAATCCTCCTCCCGATCTCAAGACGGACGAGGTCTTTCAGAACTGG
ATGCGAACAGCCGCTCTGCCGTCCTTTAGCAAATTATACCAGAGGAACGACACCGCAAGCATGGACAAGGGCCGA
TACCGAGTCACCATCAACGACTATTTCCCCACGTCGGAATACAAGGGCACCAAGTCCGTCGTCATCACGACCCGC
ACCGTCATGGGAGGCCGCAATCCATTCCTGGGAATAGCCTACCTCGTAGTCGGAGGTCTCTGCATCCTCCTCGGT
ACCGTCTTCACCGCCACCCATCTAATCAAGCCCAGAAAACTGGGCGATCACACGTACCTCTCTTGGAACAAGGTT
CCCACCGCCCCGAGAAGCGCCGGTGCTTCGGCTGCCATCGCATCGGGCCGTGAGATTCGCCCCAGCGAAGCCTAG
Transcript >Ophcf2|00983
ATGTCCGACTCGCCTCCGGACGCCGGCCAAGCCGACTCCATCAACTCGCACGAGTCAAGTCCCAAGCACTCGGAG
AAGAAGAAGAGCCGGCGGCCAGCGAATACCGCTTTTCGTCAGCAGCGTCTCAAGGCTTGGCAGCCCATCCTGACG
CCCAAGACGGTGCTACCTTTGTTCTTCACCATCGGCATCATATTCGCTCCTATCGGCGGCCTGCTTCTCTACGCC
AGCGCCAAGGTCCAGGAGATCATCATCGATTACTCAAAGTGCATACAAGAAGCACAGCAAGGTGTCTTCACCGAG
ATTCCCAGCGATAGGGTATACGCCGCCTTCAAGAGCAGCAACAGAACCATCGACGCCAAATGGTCTCGAACCGAC
AACGTCGAAGTCTTTGTGGAAAACACGGGCGTCAGGATTCAGACCCAACAATGCATCCTCGAATTCGAGATTCCC
GACAGGATGAAACCGCCCGTTCTATTCTACTACAAGCTCACAAACTTCCACCAGAACCATCGTCGCTACGTTGAA
TCGTTCGATCAGGATCAGCTCAAAGGAGAGGCTGTCCCATTCGACAAGATCAAGACGTCCAAGTGCAATCCGCTC
TACGGCGAAGACGATAAACCATACTATCCCTGCGGACTCATCGCCAACTCCATCTTCAACGATACCTTTAGCTCG
CCCGTCATGCTCAACCCCCCCGGAGCTATAGGCAACCAGACTCGCACCTATGACATGACGCAAGAGGGCATCGCC
TGGAGCAGCGACAAGGCCCTCTACGGCAAGACGACGTACCAATTCGACCAGATCCTTCCTCCACCGAACTGGCAG
AAGCGATATCCGGATGGCTACACGGATAAGAATCCTCCTCCCGATCTCAAGACGGACGAGGTCTTTCAGAACTGG
ATGCGAACAGCCGCTCTGCCGTCCTTTAGCAAATTATACCAGAGGAACGACACCGCAAGCATGGACAAGGGCCGA
TACCGAGTCACCATCAACGACTATTTCCCCACGTCGGAATACAAGGGCACCAAGTCCGTCGTCATCACGACCCGC
ACCGTCATGGGAGGCCGCAATCCATTCCTGGGAATAGCCTACCTCGTAGTCGGAGGTCTCTGCATCCTCCTCGGT
ACCGTCTTCACCGCCACCCATCTAATCAAGCCCAGAAAACTGGGCGATCACACGTACCTCTCTTGGAACAAGGTT
CCCACCGCCCCGAGAAGCGCCGGTGCTTCGGCTGCCATCGCATCGGGCCGTGAGATTCGCCCCAGCGAAGCCTAG
Gene >Ophcf2|00983
ATGTCCGACTCGCCTCCGGACGCCGGCCAAGCCGACTCCATCAACTCGCACGAGTCAAGTCCCAAGCACTCGGAG
AAGAAGAAGAGCCGGCGGCCAGCGAGTGCGTGTTCTGCGTGGTCTGCTGTGCGGTTCCTGGCGCTGACGGCGTTG
TGACCAGATACCGCTTTTCGTCAGCAGCGTCTCAAGGCTTGGCAGTGAGTCCGCCTTCCGGTTGCTGGATCTGGG
AGGCATTGCTGAGTTGCGCCAACAGGCCCATCCTGACGCCCAAGACGGTGCTACCTTTGTTCTTCACCATCGGCA
TCATATTCGCTCCTATCGGCGGCCTGCTTCTCTACGCCAGCGCCAAGGTCCAGGAGATCATCATCGATTACTCAA
AGTGCATACAAGAAGCACAGCAAGGTGTCTTCACCGAGATTCCCAGCGATAGGGTATACGCCGCCTTCAAGAGCA
GCAACAGAACCATCGACGCCAAATGGTCTCGAACCGACAACGTCGAAGTCTTTGTGGAAAACACGGGCGTCAGGA
TTCAGACCCAACAATGCATCCTCGAATTCGAGATTCCCGACAGGATGAAACCGCCCGTTCTATTCTACTACAAGC
TCACAAACTTCCACCAGAACCATCGTCGCTACGTTGAATCGTTCGATCAGGATCAGCTCAAAGGAGAGGCTGTCC
CATTCGACAAGATCAAGACGTCCAAGTGCAATCCGCTCTACGGCGAAGACGATAAACCATACTATCCCTGCGGAC
TCATCGCCAACTCCATCTTCAACGATACCTTTAGCTCGCCCGTCATGCTCAACCCCCCCGGAGCTATAGGCAACC
AGACTCGCACCTATGACATGACGCAAGAGGGCATCGCCTGGAGCAGCGACAAGGCCCTCTACGGCAAGACGACGT
ACCAATTCGACCAGATCCTTCCTCCACCGAACTGGCAGAAGCGATATCCGGATGGCTACACGGATAAGAATCCTC
CTCCCGATCTCAAGACGGACGAGGTCTTTCAGAACTGGATGCGAACAGCCGCTCTGCCGTCCTTTAGCAAATTAT
ACCAGAGGAACGACACCGCAAGCATGGACAAGGGCCGATACCGAGTCACCATCAACGACTGTGAGTCAAGCCGAC
CGAGCCCGACATGTTCGTCTGCTAATCCATCCCTCATCAGATTTCCCCACGTCGGAATACAAGGGCACCAAGTCC
GTCGTCATCACGACCCGCACCGTCATGGGAGGCCGCAATCCATTCCTGGGAATAGCCTACCTCGTAGTCGGAGGT
CTCTGCATCCTCCTCGGTACCGTCTTCACCGCCACCCATCTAATCAAGCCCAGGTCAGACCAACCTCTTGAAACT
CCCCATTCCACCCATCACCTTTCCCGCAGCTGACTCTGGCGGACAGAAAACTGGGCGATCACACGTACCTCTCTT
GGAACAAGGTTCCCACCGCCCCGAGAAGCGCCGGTGCTTCGGCTGCCATCGCATCGGGCCGTGAGATTCGCCCCA
GCGAAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail