Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00980
Gene name
Locationscaffold_01:3723108..3723480
Strand+
Gene length (bp)372
Transcript length (bp)372
Coding sequence length (bp)372
Protein length (aa) 124

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00576 Transthyretin HIUase/Transthyretin family 7.7E-33 7 122

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6917 0.3019 0.3413 0.145 0.1213 0.0114 0.2823 0.4907 0.3464 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7339
Ophiocordyceps australis map64 (Brazil) OphauB2|5398
Ophiocordyceps camponoti-floridani Ophcf2|00980 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1325
Ophiocordyceps kimflemingae Ophio5|4763
Ophiocordyceps subramaniannii Hirsu2|5477

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00980
MPTKDAITCHVLDTAAGHPAKGIRVRLEHAAVAFESLTDDDGRIVAWLPYSSAGEVPVYTLDDVLGSVEEPSNWT
LRFDTEGYFGSGNTFFPEAVVVFRVVPGQRYHVPLLLSPFGYTTYRGS*
Coding >Ophcf2|00980
ATGCCCACCAAAGACGCCATAACCTGCCACGTTCTCGACACCGCAGCCGGTCATCCGGCAAAGGGAATCCGCGTC
AGGCTCGAGCACGCGGCAGTAGCCTTCGAATCCCTTACAGACGACGACGGCCGCATCGTCGCCTGGCTACCTTAC
AGCTCCGCCGGCGAAGTCCCCGTCTACACGCTCGACGACGTCCTCGGCTCCGTCGAGGAGCCTTCCAACTGGACC
CTACGATTCGACACCGAGGGATATTTTGGCAGCGGCAATACCTTCTTCCCGGAGGCTGTCGTCGTCTTCCGCGTC
GTGCCTGGCCAGCGATATCACGTTCCCTTGCTGCTGAGCCCTTTCGGCTACACAACCTACCGGGGAAGTTGA
Transcript >Ophcf2|00980
ATGCCCACCAAAGACGCCATAACCTGCCACGTTCTCGACACCGCAGCCGGTCATCCGGCAAAGGGAATCCGCGTC
AGGCTCGAGCACGCGGCAGTAGCCTTCGAATCCCTTACAGACGACGACGGCCGCATCGTCGCCTGGCTACCTTAC
AGCTCCGCCGGCGAAGTCCCCGTCTACACGCTCGACGACGTCCTCGGCTCCGTCGAGGAGCCTTCCAACTGGACC
CTACGATTCGACACCGAGGGATATTTTGGCAGCGGCAATACCTTCTTCCCGGAGGCTGTCGTCGTCTTCCGCGTC
GTGCCTGGCCAGCGATATCACGTTCCCTTGCTGCTGAGCCCTTTCGGCTACACAACCTACCGGGGAAGTTGA
Gene >Ophcf2|00980
ATGCCCACCAAAGACGCCATAACCTGCCACGTTCTCGACACCGCAGCCGGTCATCCGGCAAAGGGAATCCGCGTC
AGGCTCGAGCACGCGGCAGTAGCCTTCGAATCCCTTACAGACGACGACGGCCGCATCGTCGCCTGGCTACCTTAC
AGCTCCGCCGGCGAAGTCCCCGTCTACACGCTCGACGACGTCCTCGGCTCCGTCGAGGAGCCTTCCAACTGGACC
CTACGATTCGACACCGAGGGATATTTTGGCAGCGGCAATACCTTCTTCCCGGAGGCTGTCGTCGTCTTCCGCGTC
GTGCCTGGCCAGCGATATCACGTTCCCTTGCTGCTGAGCCCTTTCGGCTACACAACCTACCGGGGAAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail