Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00974
Gene name
Locationscaffold_01:3713179..3713556
Strand+
Gene length (bp)377
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0653 0.0455 0.9715 0.0363 0.0782 0.0069 0.0392 0.1129 0.0296 0.0045

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999817

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5434
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4687
Ophiocordyceps australis map64 (Brazil) OphauB2|3198
Ophiocordyceps camponoti-floridani Ophcf2|00974 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1331
Ophiocordyceps kimflemingae Ophio5|2017
Ophiocordyceps subramaniannii Hirsu2|5965

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00974
MKFLAITIAALASVVAAGEYEKECKPATYSCTLEYGKPGWQVCNTSGKWEFAGFCPPKTHCKFNKVNGSPYCIPS
DWKKE*
Coding >Ophcf2|00974
ATGAAGTTCCTCGCCATCACCATCGCCGCCCTGGCCTCCGTCGTCGCCGCCGGCGAGTACGAAAAGGAGTGCAAG
CCCGCCACCTACTCCTGCACCCTCGAGTACGGCAAGCCAGGCTGGCAGGTCTGCAACACGAGCGGAAAGTGGGAG
TTCGCCGGCTTCTGCCCGCCCAAGACGCACTGCAAGTTCAACAAGGTGAACGGCAGCCCCTACTGCATCCCCAGC
GACTGGAAGAAGGAGTAA
Transcript >Ophcf2|00974
ATGAAGTTCCTCGCCATCACCATCGCCGCCCTGGCCTCCGTCGTCGCCGCCGGCGAGTACGAAAAGGAGTGCAAG
CCCGCCACCTACTCCTGCACCCTCGAGTACGGCAAGCCAGGCTGGCAGGTCTGCAACACGAGCGGAAAGTGGGAG
TTCGCCGGCTTCTGCCCGCCCAAGACGCACTGCAAGTTCAACAAGGTGAACGGCAGCCCCTACTGCATCCCCAGC
GACTGGAAGAAGGAGTAA
Gene >Ophcf2|00974
ATGAAGTTCCTCGCCATCACCATCGCCGCCCTGGCCTCCGTCGTCGCCGCCGGCGAGTACGAAAAGGAGTGCAAG
CCCGCCACCTACTCCTGCACCCTCGAGTACGGCAAGCCAGGCTGGCAGGTCTGCAACACGAGCGGAAAGTGGGAG
GTGAGTCTTTTCTCTTTTCTCTTCTCTTCTTCTGCTCCTTCTTCTTCTACTTCTTTTTCTTCTTCTTCTTCTTCT
GCTATCTGCCCTCTCCTCGCATCCACATGAACCGTGTCTGACTCACCTGCCTCGATCAGTTCGCCGGCTTCTGCC
CGCCCAAGACGCACTGCAAGTTCAACAAGGTGAACGGCAGCCCCTACTGCATCCCCAGCGACTGGAAGAAGGAGT
AA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail