Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00971
Gene name
Locationscaffold_01:3706767..3709155
Strand-
Gene length (bp)2388
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01204 Trehalase Trehalase 8.1E-188 123 686
PF07492 Trehalase_Ca-bi Neutral trehalase Ca2+ binding domain 6.2E-16 69 98

GO

GO Term Description Terminal node
GO:0005993 trehalose catabolic process Yes
GO:0005991 trehalose metabolic process Yes
GO:0004555 alpha,alpha-trehalase activity Yes
GO:0005737 cytoplasm Yes
GO:0005509 calcium ion binding Yes
GO:0046352 disaccharide catabolic process No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0005984 disaccharide metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0015927 trehalase activity No
GO:0008152 metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0009056 catabolic process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0016787 hydrolase activity No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044248 cellular catabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:1901575 organic substance catabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0009313 oligosaccharide catabolic process No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5449 0.1208 0.0984 0.084 0.2393 0.0386 0.1611 0.1533 0.2029 0.0559

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH37 1.1E-148 125 684

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1699
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|920
Ophiocordyceps australis map64 (Brazil) OphauB2|2442
Ophiocordyceps camponoti-floridani Ophcf2|00971 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1334
Ophiocordyceps kimflemingae Ophio5|2020
Ophiocordyceps subramaniannii Hirsu2|1489

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00971
MAHDGCGIYDDAKTYYASEERHSGIGSRTHSHTSLHRHPEAHEPFRRSSHDETTMLHGRRFLIQVDATLESLRAQ
EDTDGNMQITVEDNGPKVLALRTAGNNRFDVRGTYMLSNLLQELTLAKEYGRKQIILDEGRLNENPVDRLSRMIR
DHFWEGLTRRIDASSIELAARDPKDWTDDPRPRIYVPVGAPDQYEYYKRVAADRPDIRLDVRLLPERITPELIRD
MNEKPGLLAVAVEEERDADGRGTLRGLPFVVPGGRFNELYGWDSYMESLGLLIDGRVDLAKSMVLNFCFCIQHYG
KILNATRSYYLGRSQPPFLTDMALRVYERIKHEPGAQEFLRRAMLAAIKEYHSVWTCEPRLDPVTGLSRYRPEGL
GVPPETEAGHFVHILEPYLAKYGMPFEELVRAYNHGDVKEPALDEYFLHDRAVRESGHDTTYRFEGICADLATID
LNSLLFKYETDIARTIRAVFNDRLVMPAEFCGGTPYRPGDVLSSAAWDRRAKRRKLMVDRLMWNDSEGMFFDYDT
AKQERRTYESSTTFWAMWAGIATPKQAAAMVKGALPRFEAHGGLLAGTEKSRGEVGLERPNRQWDFPYGWAPQQM
LAWTGLLRYGFSEEAERLAYKWLLMITRAFVDFNGVVVEKYDVTRPADPHRVDAEYGNQGLDFEGVAKEGFGWVN
SSYVYGLEIINAHMRRALGTLTPYPTFVKAVEQTNERALAELSLTGAGAEA*
Coding >Ophcf2|00971
ATGGCACATGACGGCTGTGGCATCTACGATGACGCAAAGACGTATTACGCTTCCGAAGAACGGCACTCCGGCATC
GGCTCCCGAACCCACTCCCACACCAGCCTGCATCGGCACCCGGAGGCTCACGAGCCCTTCCGCCGTAGCAGCCAT
GACGAGACGACGATGCTGCATGGCCGACGCTTCCTGATCCAGGTCGACGCCACTCTCGAGAGCCTCCGCGCTCAG
GAGGACACCGACGGCAACATGCAGATAACGGTCGAGGACAACGGCCCCAAGGTCCTGGCTCTGCGTACCGCCGGC
AACAACCGCTTCGACGTCCGCGGCACCTACATGCTGTCCAACCTGTTGCAGGAGTTGACGCTGGCCAAGGAGTAC
GGCCGCAAGCAAATCATCCTCGACGAAGGCCGTCTCAACGAGAACCCCGTCGACCGCCTGTCCCGCATGATCCGC
GACCACTTCTGGGAGGGCCTCACCAGGCGCATCGACGCCTCCTCCATCGAGCTGGCCGCCCGCGACCCCAAGGAT
TGGACCGATGACCCTCGCCCGCGCATCTACGTCCCCGTCGGCGCCCCGGATCAGTACGAATATTACAAGCGCGTC
GCCGCCGATCGGCCAGACATCCGCCTCGACGTCCGCCTGCTGCCCGAACGCATCACGCCCGAGCTGATCCGTGAC
ATGAACGAGAAGCCGGGTCTGCTGGCCGTTGCCGTCGAGGAGGAAAGAGACGCCGATGGACGGGGGACTCTCCGT
GGTCTGCCTTTTGTCGTCCCCGGTGGTCGCTTCAACGAGCTCTATGGCTGGGACAGCTACATGGAGTCGCTCGGC
CTTCTCATCGATGGTCGCGTCGACCTGGCCAAGTCGATGGTGCTCAACTTTTGCTTCTGCATCCAGCACTACGGC
AAGATTCTCAACGCCACTAGATCTTACTACCTGGGCCGTTCCCAGCCGCCCTTCCTGACGGACATGGCCCTCCGC
GTCTACGAGCGCATCAAGCACGAGCCCGGCGCGCAAGAATTTCTCAGGCGCGCCATGCTGGCCGCCATCAAGGAG
TATCATAGCGTCTGGACGTGCGAGCCGCGTCTAGATCCCGTCACGGGTCTGTCGCGGTACCGTCCCGAGGGTCTC
GGCGTGCCACCGGAGACCGAGGCCGGCCACTTTGTGCACATCCTGGAGCCGTACCTGGCCAAATACGGCATGCCG
TTCGAGGAGCTGGTGCGTGCCTACAATCACGGCGACGTCAAGGAGCCCGCCCTTGATGAGTACTTCTTGCACGAC
CGGGCGGTGCGCGAATCGGGTCACGACACGACGTACCGCTTCGAGGGCATCTGTGCCGATTTGGCCACCATCGAC
CTCAACTCGCTGCTGTTCAAGTACGAGACGGACATTGCACGCACCATCCGTGCCGTCTTCAACGATCGGCTGGTG
ATGCCGGCCGAGTTTTGCGGCGGCACGCCCTACAGGCCCGGTGACGTGCTCTCGTCAGCGGCCTGGGATCGGAGG
GCCAAGCGGCGCAAGCTGATGGTGGACCGGCTGATGTGGAACGATTCCGAGGGCATGTTCTTCGACTACGACACT
GCCAAGCAGGAACGGCGTACGTACGAGAGCTCGACGACGTTTTGGGCCATGTGGGCCGGCATCGCGACGCCCAAG
CAGGCGGCCGCCATGGTCAAAGGGGCCCTACCGCGGTTCGAAGCCCACGGAGGCCTGCTGGCGGGCACGGAGAAG
TCGAGAGGCGAAGTCGGTTTGGAGCGGCCGAACCGGCAGTGGGACTTTCCGTACGGATGGGCGCCGCAGCAGATG
CTTGCCTGGACGGGTCTATTGCGATACGGATTCAGCGAAGAGGCGGAGAGATTGGCCTACAAGTGGCTCCTGATG
ATTACCCGAGCCTTTGTCGACTTCAACGGCGTCGTGGTGGAAAAGTACGACGTGACGCGGCCGGCTGATCCGCAC
CGGGTTGACGCCGAGTACGGGAACCAGGGGTTGGACTTTGAGGGCGTGGCCAAGGAGGGCTTCGGCTGGGTCAAC
TCGAGCTACGTATACGGACTGGAGATTATCAACGCACACATGCGGCGCGCCCTGGGCACGTTGACGCCGTATCCG
ACGTTTGTCAAGGCGGTGGAACAGACCAACGAACGGGCGCTGGCCGAGCTGTCGCTGACGGGAGCCGGTGCCGAG
GCCTGA
Transcript >Ophcf2|00971
ATGGCACATGACGGCTGTGGCATCTACGATGACGCAAAGACGTATTACGCTTCCGAAGAACGGCACTCCGGCATC
GGCTCCCGAACCCACTCCCACACCAGCCTGCATCGGCACCCGGAGGCTCACGAGCCCTTCCGCCGTAGCAGCCAT
GACGAGACGACGATGCTGCATGGCCGACGCTTCCTGATCCAGGTCGACGCCACTCTCGAGAGCCTCCGCGCTCAG
GAGGACACCGACGGCAACATGCAGATAACGGTCGAGGACAACGGCCCCAAGGTCCTGGCTCTGCGTACCGCCGGC
AACAACCGCTTCGACGTCCGCGGCACCTACATGCTGTCCAACCTGTTGCAGGAGTTGACGCTGGCCAAGGAGTAC
GGCCGCAAGCAAATCATCCTCGACGAAGGCCGTCTCAACGAGAACCCCGTCGACCGCCTGTCCCGCATGATCCGC
GACCACTTCTGGGAGGGCCTCACCAGGCGCATCGACGCCTCCTCCATCGAGCTGGCCGCCCGCGACCCCAAGGAT
TGGACCGATGACCCTCGCCCGCGCATCTACGTCCCCGTCGGCGCCCCGGATCAGTACGAATATTACAAGCGCGTC
GCCGCCGATCGGCCAGACATCCGCCTCGACGTCCGCCTGCTGCCCGAACGCATCACGCCCGAGCTGATCCGTGAC
ATGAACGAGAAGCCGGGTCTGCTGGCCGTTGCCGTCGAGGAGGAAAGAGACGCCGATGGACGGGGGACTCTCCGT
GGTCTGCCTTTTGTCGTCCCCGGTGGTCGCTTCAACGAGCTCTATGGCTGGGACAGCTACATGGAGTCGCTCGGC
CTTCTCATCGATGGTCGCGTCGACCTGGCCAAGTCGATGGTGCTCAACTTTTGCTTCTGCATCCAGCACTACGGC
AAGATTCTCAACGCCACTAGATCTTACTACCTGGGCCGTTCCCAGCCGCCCTTCCTGACGGACATGGCCCTCCGC
GTCTACGAGCGCATCAAGCACGAGCCCGGCGCGCAAGAATTTCTCAGGCGCGCCATGCTGGCCGCCATCAAGGAG
TATCATAGCGTCTGGACGTGCGAGCCGCGTCTAGATCCCGTCACGGGTCTGTCGCGGTACCGTCCCGAGGGTCTC
GGCGTGCCACCGGAGACCGAGGCCGGCCACTTTGTGCACATCCTGGAGCCGTACCTGGCCAAATACGGCATGCCG
TTCGAGGAGCTGGTGCGTGCCTACAATCACGGCGACGTCAAGGAGCCCGCCCTTGATGAGTACTTCTTGCACGAC
CGGGCGGTGCGCGAATCGGGTCACGACACGACGTACCGCTTCGAGGGCATCTGTGCCGATTTGGCCACCATCGAC
CTCAACTCGCTGCTGTTCAAGTACGAGACGGACATTGCACGCACCATCCGTGCCGTCTTCAACGATCGGCTGGTG
ATGCCGGCCGAGTTTTGCGGCGGCACGCCCTACAGGCCCGGTGACGTGCTCTCGTCAGCGGCCTGGGATCGGAGG
GCCAAGCGGCGCAAGCTGATGGTGGACCGGCTGATGTGGAACGATTCCGAGGGCATGTTCTTCGACTACGACACT
GCCAAGCAGGAACGGCGTACGTACGAGAGCTCGACGACGTTTTGGGCCATGTGGGCCGGCATCGCGACGCCCAAG
CAGGCGGCCGCCATGGTCAAAGGGGCCCTACCGCGGTTCGAAGCCCACGGAGGCCTGCTGGCGGGCACGGAGAAG
TCGAGAGGCGAAGTCGGTTTGGAGCGGCCGAACCGGCAGTGGGACTTTCCGTACGGATGGGCGCCGCAGCAGATG
CTTGCCTGGACGGGTCTATTGCGATACGGATTCAGCGAAGAGGCGGAGAGATTGGCCTACAAGTGGCTCCTGATG
ATTACCCGAGCCTTTGTCGACTTCAACGGCGTCGTGGTGGAAAAGTACGACGTGACGCGGCCGGCTGATCCGCAC
CGGGTTGACGCCGAGTACGGGAACCAGGGGTTGGACTTTGAGGGCGTGGCCAAGGAGGGCTTCGGCTGGGTCAAC
TCGAGCTACGTATACGGACTGGAGATTATCAACGCACACATGCGGCGCGCCCTGGGCACGTTGACGCCGTATCCG
ACGTTTGTCAAGGCGGTGGAACAGACCAACGAACGGGCGCTGGCCGAGCTGTCGCTGACGGGAGCCGGTGCCGAG
GCCTGA
Gene >Ophcf2|00971
ATGGCACATGACGGCTGTGGCATCTACGATGACGCAAAGACGTATTACGCTTCCGAAGAACGGCACTCCGGCATC
GGCTCCCGAACCCACTCCCACGTCCGTCTCTCCCGTTCGGTCCGACGCTCTTGGCCGAGACTGACGGCCGGAAAC
AGACCAGCCTGCATCGGCACCCGGAGGCTCACGAGCCCTTCCGCCGTAGCAGCCATGGTCCGTCCCGTCTCTGCT
CGCTGCGACTGGTGGACGCTGATGGACGATGATGGACGCTGATGGACGCTGATGGACGGCAGACGAGACGACGAT
GCTGCATGGCCGACGCTTCCTGATCCAGGTCGACGCCACTCTCGAGAGCCTCCGCGCTCAGGAGGACACCGACGG
CAACATGCAGATAACGGTCGAGGACAACGGCCCCAAGGTCCTGGCTCTGCGTACCGCCGGCAACAACCGCTTCGA
CGTCCGCGGCACCTACATGCTGTCCAACCTGTTGCAGGAGTTGACGCTGGCCAAGGAGTACGGCCGCAAGCAAAT
CATCCTCGACGAAGGCCGTCTCAACGAGAACCCCGTCGACCGCCTGTCCCGCATGATCCGCGACCACTTCTGGGA
GGGCCTCACCAGGCGCATCGACGCCTCCTCCATCGAGCTGGCCGCCCGCGACCCCAAGGATTGGACCGATGACCC
TCGCCCGCGCATCTACGTCCCCGTCGGCGCCCCGGATCAGTACGAATATTACAAGCGCGTCGCCGCCGATCGGCC
AGACATCCGCCTCGACGTCCGCCTGCTGCCCGAACGCATCACGCCCGAGCTGATCCGTGACATGAACGAGAAGCC
GGGTCTGCTGGCCGTTGCCGTCGAGGAGGAAAGAGACGCCGATGGACGGGGGACTCTCCGTGGTCTGCCTTTTGT
CGTCCCCGGTGGTCGCTTCAACGAGCTCTATGGCTGGGACAGCTACATGGAGTCGCTCGGCCTTCTCATCGATGG
TCGCGTCGACCTGGCCAAGTCGATGGTGCTCAACTTTTGCTTCTGCATCCAGCACTACGGCAAGATTCTCAACGC
CACTAGATCTTACTACCTGGGCCGTTCCCAGCCGCCCTTCCTGACGGACATGGCCCTCCGCGTCTACGAGCGCAT
CAAGCACGAGCCCGGCGCGCAAGAATTTCTCAGGCGCGCCATGCTGGCCGCCATCAAGGAGTATCATAGCGTCTG
GACGTGCGAGCCGCGTCTAGATCCCGTCACGGGTCTGTCGCGGTACCGTCCCGAGGGTCTCGGCGTGCCACCGGA
GACCGAGGCCGGCCACTTTGTGCACATCCTGGAGCCGTACCTGGCCAAATACGGCATGCCGTTCGAGGAGCTGGT
GCGTGCCTACAATCACGGCGACGTCAAGGAGCCCGCCCTTGATGAGTACTTCTTGCACGACCGGGCGGTGCGCGA
ATCGGGTCACGACACGACGTACCGCTTCGAGGGCATCTGTGCCGATTTGGCCACCATCGACCTCAACTCGCTGCT
GTTCAAGTACGAGACGGACATTGCACGCACCATCCGTGCCGTCTTCAACGATCGGCTGGTGATGCCGGCCGAGTT
TTGCGGCGGCACGCCCTACAGGCCCGGTGACGTGCTCTCGTCAGCGGCCTGGGATCGGAGGGCCAAGCGGCGCAA
GCTGATGGTGGACCGGCTGATGTGGAACGATTCCGAGGGCATGTTCTTCGACTACGACACTGCCAAGCAGGAACG
GCGTACGTACGAGAGCTCGACGACGTTTTGGGCCATGTGGGCCGGCATCGCGACGCCCAAGCAGGCGGCCGCCAT
GGTCAAAGGGGCCCTACCGCGGTTCGAAGCCCACGGAGGCCTGCTGGCGGGCACGGAGAAGTCGAGAGGCGAAGT
CGGTTTGGAGCGGCCGAACCGGCAGTGGGACTTTCCGTACGGATGGGCGCCGCAGCAGATGCTTGCCTGGACGGG
TCTATTGCGATACGGATTCAGCGAAGAGGCGGAGAGATTGGCCTACAAGTGGCTCCTGATGATTACCCGAGCCTT
TGTCGACTTCAACGGCGTCGTGGTGGAAAAGTACGACGTGACGCGGCCGGCTGATCCGCACCGGGTTGACGCCGA
GTACGGGAACCAGGGGTTGGACTTTGAGGGCGTGGCCAAGGAGGGGTGAGCCATCTCTTTCATTAAACATCATGT
TCCCCTCCTTTTTCATCGAATGAGTTACTGACGGAACGCAGCTTCGGCTGGGTCAACTCGAGCTACGTATACGGA
CTGGAGATTATCAACGCACACATGCGGCGCGCCCTGGGCACGTTGACGCCGTATCCGACGTTTGTCAAGGCGGTG
GAACAGACCAACGAACGGGCGCTGGCCGAGCTGTCGCTGACGGGAGCCGGTGCCGAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail