Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00965
Gene name
Locationscaffold_01:3691834..3692576
Strand-
Gene length (bp)742
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 7.0E-11 26 191
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.3E-07 85 187
PF13242 Hydrolase_like HAD-hyrolase-like 4.9E-05 143 198

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7236 0.4908 0.0493 0.0634 0.2382 0.2422 0.0799 0.1773 0.0592 0.2666

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3306
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6443
Ophiocordyceps australis map64 (Brazil) OphauB2|3322
Ophiocordyceps camponoti-floridani Ophcf2|00965 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2671
Ophiocordyceps kimflemingae Ophio5|1028
Ophiocordyceps subramaniannii Hirsu2|6090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00965
MSTSRWFASMFAHVDDSAPSPILRGIIFDMDGTLCQPQTYMFAEMRAALGIGPSVDILHHIDSLPYDRQPAAAAA
IRAIEGRAMLSQKPQPGLGRLMSYLDARGIPKAICTRNYDLPVQNLLSKFLVGSIFSPVVTRDFRPPKPHPAGLL
HIAACWGLYGDDGQPDASNLIMVGDSLDDMTAGRMAGATTVLLVNDVNYGLARHPHTDLTIKRLDELVAILEWGF
EFAR*
Coding >Ophcf2|00965
ATGTCTACTTCCAGGTGGTTTGCCTCCATGTTCGCTCACGTCGACGACTCGGCCCCTTCGCCGATCCTTCGAGGC
ATAATCTTCGACATGGACGGGACGCTGTGCCAACCGCAGACTTACATGTTCGCCGAGATGAGAGCTGCCCTCGGT
ATAGGCCCCTCGGTCGACATCCTCCATCACATCGACAGCCTGCCCTACGACCGCCAGCCTGCCGCCGCCGCCGCC
ATCCGCGCCATCGAGGGCCGTGCCATGCTCTCGCAGAAGCCCCAGCCGGGTCTTGGCCGCCTCATGTCTTACCTC
GACGCTCGAGGGATCCCCAAGGCTATTTGCACCCGAAACTATGATCTGCCCGTCCAGAATCTCCTATCCAAGTTT
TTGGTCGGCTCCATCTTTAGCCCCGTCGTCACTAGAGACTTTCGGCCTCCGAAACCTCATCCGGCCGGCCTGCTG
CACATTGCTGCTTGCTGGGGGCTGTATGGCGATGACGGTCAGCCGGATGCCAGCAACTTAATCATGGTCGGCGAC
TCGCTCGATGACATGACGGCCGGGAGGATGGCCGGAGCCACTACCGTCTTGCTCGTCAACGACGTGAATTACGGC
CTGGCCCGCCACCCACACACGGACCTGACCATCAAGAGGCTTGACGAGCTTGTTGCCATTTTGGAATGGGGTTTT
GAATTTGCTCGCTAG
Transcript >Ophcf2|00965
ATGTCTACTTCCAGGTGGTTTGCCTCCATGTTCGCTCACGTCGACGACTCGGCCCCTTCGCCGATCCTTCGAGGC
ATAATCTTCGACATGGACGGGACGCTGTGCCAACCGCAGACTTACATGTTCGCCGAGATGAGAGCTGCCCTCGGT
ATAGGCCCCTCGGTCGACATCCTCCATCACATCGACAGCCTGCCCTACGACCGCCAGCCTGCCGCCGCCGCCGCC
ATCCGCGCCATCGAGGGCCGTGCCATGCTCTCGCAGAAGCCCCAGCCGGGTCTTGGCCGCCTCATGTCTTACCTC
GACGCTCGAGGGATCCCCAAGGCTATTTGCACCCGAAACTATGATCTGCCCGTCCAGAATCTCCTATCCAAGTTT
TTGGTCGGCTCCATCTTTAGCCCCGTCGTCACTAGAGACTTTCGGCCTCCGAAACCTCATCCGGCCGGCCTGCTG
CACATTGCTGCTTGCTGGGGGCTGTATGGCGATGACGGTCAGCCGGATGCCAGCAACTTAATCATGGTCGGCGAC
TCGCTCGATGACATGACGGCCGGGAGGATGGCCGGAGCCACTACCGTCTTGCTCGTCAACGACGTGAATTACGGC
CTGGCCCGCCACCCACACACGGACCTGACCATCAAGAGGCTTGACGAGCTTGTTGCCATTTTGGAATGGGGTTTT
GAATTTGCTCGCTAG
Gene >Ophcf2|00965
ATGTCTACTTCCAGGTGGTTTGCCTCCATGTTCGCTCACGTCGACGACTCGGCCCCTTCGCCGATCCTTCGAGGC
ATAATCTTCGACATGGACGGGACGCTGTGGTGACTTGACCTATTCTCTATCAAAGCTATTCCGGTCACTGACCAC
GCTCAGCCAACCGCAGACTTACATGTTCGCCGAGATGAGAGCTGCCCTCGGTATAGGCCCCTCGGTCGACATCCT
CCATCACATCGACAGCCTGCCCTACGACCGCCAGCCTGCCGCCGCCGCCGCCATCCGCGCCATCGAGGGCCGTGC
CATGCTCTCGCAGAAGCCCCAGCCGGGTCTTGGCCGCCTCATGTCTTACCTCGACGCTCGAGGGATCCCCAAGGC
TATTTGCACCCGAAACTATGATCTGCCCGTCCAGAATCTCCTATCCAAGTTTTTGGTCGGCTCCATCTTTAGCCC
CGTCGTCACTAGAGACTTTCGGCCTCCGAAACCTCATCCGGCCGGCCTGCTGCACATTGCTGCTTGCTGGGGGCT
GTATGGCGATGACGGTCAGCCGGATGCCAGCAACTTAATCATGGTCGGCGACTCGCTCGATGACATGACGGCCGG
GAGGATGGCCGGAGCCACTACCGTCTTGCTCGTCAACGACGTGAATTACGGCCTGGCCCGCCACCCACACACGGA
CCTGACCATCAAGAGGCTTGACGAGCTTGTTGCCATTTTGGAATGGGGTTTTGAATTTGCTCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail