Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00963
Gene name
Locationscaffold_01:3683387..3687819
Strand-
Gene length (bp)4432
Transcript length (bp)4239
Coding sequence length (bp)4239
Protein length (aa) 1413

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14633 SH2_2 SH2 domain 2.6E-86 1191 1400
PF14641 HTH_44 Helix-turn-helix DNA-binding domain of SPT6 4.3E-36 299 421
PF14639 YqgF Holliday-junction resolvase-like of SPT6 5.1E-30 710 865
PF14635 HHH_7 Helix-hairpin-helix motif 1.6E-30 867 976
PF14632 SPT6_acidic Acidic N-terminal SPT6 9.5E-22 41 138
PF17674 HHH_9 HHH domain 3.7E-05 985 1029
PF00575 S1 S1 RNA binding domain 1.6E-04 1104 1171

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2424 0.8662 0.0634 0.0183 0.1169 0.045 0.0305 0.0103 0.0175 0.0053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3308
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6439
Ophiocordyceps australis map64 (Brazil) OphauB2|4168
Ophiocordyceps camponoti-floridani Ophcf2|00963 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2669
Ophiocordyceps kimflemingae Ophio5|1032
Ophiocordyceps subramaniannii Hirsu2|6094

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00963
MSSSMRDLISAEAELDEEEDESFDEETGQERRRAKGPRFEDSSEEEEDDDDEEEARKVREGFIVDEDEEEDEEQE
QEEKAGSDTEERHIVKRKREHRDREEEERLDEEDLELIGEQFGPRPKSQPQSKFKRLKRGHRDEDESANERRGLE
EIFSDEDEDAGEQRPYGRSSFRAQADEFDDFIEEDFPEDDDERLRQLEDAEVARPRDRGVGAVVDTSGLDKDALD
DMEAIFGNGEDYDWALQLEDEEDDREREEQAIELKDVFEPSQLKEKLLTDEDNEIRFTDEPERFQLDRKPFKNLQ
LTAEQFREEARWITDRLPKKSSQELQAPFVKAVSKVLEFFIVDEVEVPYVFQHRKDYLLHSKKIRRSTRDDPDGP
DYTIQSDKLLNQDDLWKILELDIRFRSFVEKRNSIEKTLKSLDVDDPILADMMPQATQMEELQDLQDYLHFQYSI
KLKDLAALSGNASLTKRPGSKSSLFDRVRTGQASKFVEAYGISADQLAKNALRQGKKVVPDGDDQYPLDLADSLI
DDSFNTGDQVMNAARQLFSEELFVSPRLRKHFRACYYQGGEISCRRTDKGLRKIDDLHPYYDIKYLQNRPISDFA
DQPELILKMMRAEEEGLVEVKVNMPPEYEFRRQLYKEFKSDNYSDRAEQWNQERKKVLDLAFPKLEKLIAKNFKE
VVRTFCQDEVLKKCRQEFYRKLDQAPYKPKGMVLGTTPRVLTLSNGMGDPFRDPICWAWVEEDGRVLEQGKFGNL
AKDEAQRDEFVELVQRRRPDVIGVSGWCADTNRLVRDLENLVSEKGLMGPEFDDPETNDYRAEPLEVVVVDDEVA
RLYKDSPRAVAEHPSLNPVTRYCIALARYMQNPLKEYAALGRDIGSLSYHPCQQLLPQDKLMKYLESAMVDTVNM
VGVNINDAMTDPYTANLLPYVAGLGPRKATSVVKAINANGGSVNTRDELVGDPDSGKLPVVGPRVWNNCASFLYM
DYDATNPSSDPLDNTRVHPEDYELGRKMAADALELDEEDVKAETDENGPGAIVRKLFKQDEQERVNELVLDEYAD
QLLKNFNQRKRATLEAISAELQAPYEELRRSFSPPNPYDVFTMFTGETKSSLCEGMIVPVNVRVVRDDFAIVKLD
CGIEGRVEAHEVTSRGSVKDVLSTGQTAQAKILEMSYKDMVAKLSMREESLRIPYKRPTNHERDWWDYDLEKQDK
DDLQEKDKTTGRTQRVVKHPNFKPFNSVQAEEYLGSQPAGEVIVRPSSKGNDHLAVTWKVADNVYQHIDVLEMLK
ENEFSVGKLLRVGGKYTYSDLDELIVDHVKAMARKVEEMMRHDKFQKMSKPETEKWLTTYSDANPNRSTYAFCLD
TKHPGYFWLCFKASRTARVIGLPVRSIPQGYELRNYQYPDMRALCNGFKLRYQNEFSKMGTK*
Coding >Ophcf2|00963
ATGAGCAGTTCCATGCGCGACCTGATTTCGGCCGAGGCTGAGCTCGATGAAGAGGAAGACGAGTCTTTTGATGAA
GAAACCGGTCAGGAACGGAGACGGGCCAAAGGGCCCCGCTTCGAGGACTCTAGCGAAGAAGAAGAGGATGACGAT
GACGAGGAAGAAGCGCGCAAGGTCCGCGAGGGATTCATAGTTGACGAAGACGAAGAGGAAGATGAAGAGCAGGAG
CAGGAGGAGAAAGCCGGCTCCGATACCGAGGAACGTCACATAGTCAAGAGGAAGCGAGAGCACAGAGATCGCGAG
GAAGAGGAGCGCCTCGACGAAGAAGACTTGGAACTCATCGGCGAGCAGTTTGGTCCGCGTCCCAAGTCTCAGCCT
CAGTCAAAGTTCAAGCGCCTCAAACGTGGTCATCGTGACGAGGACGAATCCGCAAACGAGCGTCGCGGGCTCGAG
GAAATATTTTCTGATGAAGACGAAGATGCCGGAGAACAGCGACCGTACGGCAGATCGAGCTTTCGTGCTCAAGCG
GACGAGTTCGACGACTTCATCGAGGAAGACTTTCCCGAAGACGACGATGAGCGACTGCGGCAGCTCGAGGACGCC
GAGGTGGCTCGCCCTAGGGATCGGGGCGTCGGTGCCGTGGTCGATACATCCGGACTCGACAAGGATGCTCTCGAC
GACATGGAGGCCATCTTCGGCAATGGCGAGGACTACGACTGGGCTCTTCAGCTCGAGGACGAAGAGGATGACCGC
GAAAGGGAGGAGCAGGCCATTGAGCTCAAAGACGTTTTCGAACCCTCCCAACTCAAGGAGAAGCTACTCACCGAT
GAGGACAACGAGATCAGGTTCACCGACGAGCCCGAACGATTTCAACTGGACCGAAAGCCCTTCAAAAACCTCCAG
CTTACGGCTGAGCAGTTTCGGGAGGAAGCCAGGTGGATCACTGACCGCTTGCCAAAGAAGAGCTCGCAGGAACTT
CAGGCCCCGTTCGTCAAGGCCGTCAGCAAAGTGCTCGAGTTTTTCATCGTGGACGAAGTCGAGGTGCCCTACGTC
TTTCAGCACCGCAAGGATTACCTCCTCCACTCCAAGAAGATTAGGAGGTCGACACGGGACGATCCAGATGGCCCG
GACTACACCATCCAGTCAGACAAGCTTCTGAACCAGGATGACCTGTGGAAAATTCTCGAGCTGGATATTCGGTTC
CGTTCGTTTGTGGAAAAGAGAAACTCCATCGAAAAGACGCTCAAGTCGCTCGACGTCGACGACCCCATCCTTGCA
GACATGATGCCGCAAGCAACGCAGATGGAAGAACTCCAGGATCTGCAAGACTATCTGCATTTTCAATACAGTATC
AAGCTGAAGGACTTGGCAGCCCTGTCTGGCAACGCTTCGCTGACGAAACGACCCGGATCAAAGTCTTCGCTATTC
GACCGCGTCCGTACTGGTCAAGCTTCAAAATTCGTTGAGGCGTACGGCATCTCGGCCGATCAGCTGGCCAAGAAC
GCACTCCGTCAGGGCAAAAAGGTTGTTCCCGACGGGGACGACCAATATCCCTTGGATCTCGCCGACAGCCTGATC
GACGACAGCTTCAACACGGGCGACCAGGTCATGAACGCCGCCCGGCAGCTGTTTTCCGAGGAGCTGTTCGTGAGC
CCGAGGCTGCGGAAGCACTTTCGCGCCTGCTACTATCAAGGGGGCGAGATTAGCTGTCGACGGACGGATAAGGGG
CTGCGCAAAATCGACGACTTGCACCCTTACTACGACATCAAGTACTTGCAGAACCGGCCGATTTCCGATTTCGCC
GACCAACCCGAGCTGATCTTGAAGATGATGCGAGCCGAGGAGGAGGGCCTGGTCGAGGTCAAGGTCAACATGCCG
CCTGAATACGAATTCCGTCGACAGCTGTACAAGGAGTTTAAATCGGACAACTACAGCGACCGGGCAGAACAGTGG
AACCAGGAACGCAAGAAAGTGCTGGATCTCGCGTTTCCTAAGCTTGAGAAGCTCATCGCCAAGAACTTCAAGGAG
GTGGTCCGCACGTTTTGCCAGGACGAGGTGCTCAAGAAGTGTCGGCAGGAATTTTACAGAAAGCTCGACCAGGCT
CCGTATAAGCCCAAGGGTATGGTTCTGGGCACGACGCCGCGCGTCTTGACGCTTTCGAACGGCATGGGGGACCCC
TTCCGAGACCCGATATGCTGGGCCTGGGTCGAGGAGGATGGCCGGGTTCTGGAGCAGGGAAAGTTTGGCAACCTC
GCCAAGGACGAGGCGCAACGCGACGAGTTTGTAGAGCTCGTCCAACGCCGCCGGCCCGATGTGATTGGCGTGAGC
GGCTGGTGCGCCGACACCAACAGGCTGGTGCGCGACCTGGAGAACCTGGTGAGCGAAAAGGGGCTCATGGGCCCC
GAGTTCGACGATCCCGAGACCAACGACTACCGCGCCGAGCCGCTCGAGGTGGTGGTGGTGGACGACGAGGTGGCC
AGGCTGTACAAGGACAGCCCGCGCGCCGTGGCAGAGCATCCGTCGCTCAACCCCGTCACGCGATACTGCATCGCC
CTGGCTCGATACATGCAGAACCCTCTCAAGGAGTACGCGGCCCTGGGCAGAGACATTGGGTCGCTGTCGTACCAC
CCGTGCCAGCAACTGCTGCCGCAGGACAAGCTGATGAAGTATCTGGAGTCGGCCATGGTGGACACGGTCAACATG
GTGGGCGTCAACATCAACGACGCCATGACGGACCCGTACACGGCAAACCTGCTGCCGTACGTGGCCGGGCTTGGG
CCGCGGAAGGCGACGAGCGTTGTTAAGGCCATCAATGCCAACGGAGGCTCCGTCAACACCAGGGACGAGCTCGTG
GGCGACCCGGACAGCGGCAAGCTGCCAGTGGTTGGGCCCAGGGTGTGGAATAACTGCGCCAGCTTCCTGTATATG
GATTACGACGCGACGAACCCGTCGTCGGATCCGCTCGATAACACGCGAGTTCACCCGGAGGACTACGAGCTCGGG
CGCAAGATGGCGGCCGACGCCTTGGAACTGGACGAGGAGGACGTCAAGGCCGAGACGGACGAGAACGGCCCCGGG
GCCATCGTGCGGAAGCTGTTTAAGCAGGACGAACAGGAGCGAGTCAACGAGCTGGTGCTTGACGAGTACGCGGAC
CAGCTGCTCAAGAACTTCAACCAGCGGAAGCGGGCGACGCTCGAGGCTATCAGCGCCGAGTTGCAAGCGCCATAC
GAGGAGCTTCGACGTAGCTTCTCGCCGCCGAACCCCTACGACGTCTTCACCATGTTCACGGGCGAGACCAAGAGT
TCGCTCTGTGAAGGTATGATTGTGCCGGTCAACGTACGCGTCGTACGCGACGATTTCGCCATCGTCAAGCTCGAC
TGCGGCATCGAGGGCCGGGTCGAGGCGCACGAGGTGACGAGCCGCGGGTCGGTCAAGGATGTGCTGAGCACGGGA
CAGACGGCGCAGGCCAAGATCCTGGAGATGAGCTACAAGGACATGGTGGCCAAGCTGTCGATGCGGGAAGAGTCG
CTCAGAATCCCGTACAAGCGGCCGACGAACCACGAGCGCGACTGGTGGGACTACGACCTCGAGAAGCAGGACAAG
GACGACCTCCAGGAAAAGGACAAGACGACGGGGCGGACGCAGCGTGTGGTGAAGCACCCCAACTTCAAGCCCTTC
AACTCGGTCCAGGCCGAGGAGTACCTGGGCTCTCAGCCGGCGGGCGAGGTGATTGTTCGGCCGTCGTCCAAGGGC
AACGACCACCTGGCGGTGACGTGGAAGGTGGCGGACAACGTGTACCAGCACATTGACGTGCTGGAGATGCTCAAG
GAGAACGAGTTCTCGGTCGGCAAGCTGCTGCGGGTCGGGGGCAAGTACACGTACAGCGACCTGGACGAGTTGATT
GTGGACCACGTCAAGGCCATGGCGAGAAAGGTAGAGGAGATGATGCGGCACGACAAGTTCCAGAAAATGTCCAAA
CCCGAGACGGAGAAGTGGTTGACGACGTACAGTGACGCCAACCCCAACCGGTCGACGTACGCCTTTTGTCTCGAC
ACGAAGCATCCGGGCTACTTCTGGCTGTGCTTCAAGGCGAGCCGGACGGCGCGGGTTATTGGACTGCCGGTACGG
TCGATCCCGCAGGGGTACGAGCTCCGAAACTACCAGTACCCGGACATGAGGGCGCTGTGCAACGGCTTCAAGCTG
CGGTATCAGAACGAGTTTTCCAAGATGGGCACGAAGTGA
Transcript >Ophcf2|00963
ATGAGCAGTTCCATGCGCGACCTGATTTCGGCCGAGGCTGAGCTCGATGAAGAGGAAGACGAGTCTTTTGATGAA
GAAACCGGTCAGGAACGGAGACGGGCCAAAGGGCCCCGCTTCGAGGACTCTAGCGAAGAAGAAGAGGATGACGAT
GACGAGGAAGAAGCGCGCAAGGTCCGCGAGGGATTCATAGTTGACGAAGACGAAGAGGAAGATGAAGAGCAGGAG
CAGGAGGAGAAAGCCGGCTCCGATACCGAGGAACGTCACATAGTCAAGAGGAAGCGAGAGCACAGAGATCGCGAG
GAAGAGGAGCGCCTCGACGAAGAAGACTTGGAACTCATCGGCGAGCAGTTTGGTCCGCGTCCCAAGTCTCAGCCT
CAGTCAAAGTTCAAGCGCCTCAAACGTGGTCATCGTGACGAGGACGAATCCGCAAACGAGCGTCGCGGGCTCGAG
GAAATATTTTCTGATGAAGACGAAGATGCCGGAGAACAGCGACCGTACGGCAGATCGAGCTTTCGTGCTCAAGCG
GACGAGTTCGACGACTTCATCGAGGAAGACTTTCCCGAAGACGACGATGAGCGACTGCGGCAGCTCGAGGACGCC
GAGGTGGCTCGCCCTAGGGATCGGGGCGTCGGTGCCGTGGTCGATACATCCGGACTCGACAAGGATGCTCTCGAC
GACATGGAGGCCATCTTCGGCAATGGCGAGGACTACGACTGGGCTCTTCAGCTCGAGGACGAAGAGGATGACCGC
GAAAGGGAGGAGCAGGCCATTGAGCTCAAAGACGTTTTCGAACCCTCCCAACTCAAGGAGAAGCTACTCACCGAT
GAGGACAACGAGATCAGGTTCACCGACGAGCCCGAACGATTTCAACTGGACCGAAAGCCCTTCAAAAACCTCCAG
CTTACGGCTGAGCAGTTTCGGGAGGAAGCCAGGTGGATCACTGACCGCTTGCCAAAGAAGAGCTCGCAGGAACTT
CAGGCCCCGTTCGTCAAGGCCGTCAGCAAAGTGCTCGAGTTTTTCATCGTGGACGAAGTCGAGGTGCCCTACGTC
TTTCAGCACCGCAAGGATTACCTCCTCCACTCCAAGAAGATTAGGAGGTCGACACGGGACGATCCAGATGGCCCG
GACTACACCATCCAGTCAGACAAGCTTCTGAACCAGGATGACCTGTGGAAAATTCTCGAGCTGGATATTCGGTTC
CGTTCGTTTGTGGAAAAGAGAAACTCCATCGAAAAGACGCTCAAGTCGCTCGACGTCGACGACCCCATCCTTGCA
GACATGATGCCGCAAGCAACGCAGATGGAAGAACTCCAGGATCTGCAAGACTATCTGCATTTTCAATACAGTATC
AAGCTGAAGGACTTGGCAGCCCTGTCTGGCAACGCTTCGCTGACGAAACGACCCGGATCAAAGTCTTCGCTATTC
GACCGCGTCCGTACTGGTCAAGCTTCAAAATTCGTTGAGGCGTACGGCATCTCGGCCGATCAGCTGGCCAAGAAC
GCACTCCGTCAGGGCAAAAAGGTTGTTCCCGACGGGGACGACCAATATCCCTTGGATCTCGCCGACAGCCTGATC
GACGACAGCTTCAACACGGGCGACCAGGTCATGAACGCCGCCCGGCAGCTGTTTTCCGAGGAGCTGTTCGTGAGC
CCGAGGCTGCGGAAGCACTTTCGCGCCTGCTACTATCAAGGGGGCGAGATTAGCTGTCGACGGACGGATAAGGGG
CTGCGCAAAATCGACGACTTGCACCCTTACTACGACATCAAGTACTTGCAGAACCGGCCGATTTCCGATTTCGCC
GACCAACCCGAGCTGATCTTGAAGATGATGCGAGCCGAGGAGGAGGGCCTGGTCGAGGTCAAGGTCAACATGCCG
CCTGAATACGAATTCCGTCGACAGCTGTACAAGGAGTTTAAATCGGACAACTACAGCGACCGGGCAGAACAGTGG
AACCAGGAACGCAAGAAAGTGCTGGATCTCGCGTTTCCTAAGCTTGAGAAGCTCATCGCCAAGAACTTCAAGGAG
GTGGTCCGCACGTTTTGCCAGGACGAGGTGCTCAAGAAGTGTCGGCAGGAATTTTACAGAAAGCTCGACCAGGCT
CCGTATAAGCCCAAGGGTATGGTTCTGGGCACGACGCCGCGCGTCTTGACGCTTTCGAACGGCATGGGGGACCCC
TTCCGAGACCCGATATGCTGGGCCTGGGTCGAGGAGGATGGCCGGGTTCTGGAGCAGGGAAAGTTTGGCAACCTC
GCCAAGGACGAGGCGCAACGCGACGAGTTTGTAGAGCTCGTCCAACGCCGCCGGCCCGATGTGATTGGCGTGAGC
GGCTGGTGCGCCGACACCAACAGGCTGGTGCGCGACCTGGAGAACCTGGTGAGCGAAAAGGGGCTCATGGGCCCC
GAGTTCGACGATCCCGAGACCAACGACTACCGCGCCGAGCCGCTCGAGGTGGTGGTGGTGGACGACGAGGTGGCC
AGGCTGTACAAGGACAGCCCGCGCGCCGTGGCAGAGCATCCGTCGCTCAACCCCGTCACGCGATACTGCATCGCC
CTGGCTCGATACATGCAGAACCCTCTCAAGGAGTACGCGGCCCTGGGCAGAGACATTGGGTCGCTGTCGTACCAC
CCGTGCCAGCAACTGCTGCCGCAGGACAAGCTGATGAAGTATCTGGAGTCGGCCATGGTGGACACGGTCAACATG
GTGGGCGTCAACATCAACGACGCCATGACGGACCCGTACACGGCAAACCTGCTGCCGTACGTGGCCGGGCTTGGG
CCGCGGAAGGCGACGAGCGTTGTTAAGGCCATCAATGCCAACGGAGGCTCCGTCAACACCAGGGACGAGCTCGTG
GGCGACCCGGACAGCGGCAAGCTGCCAGTGGTTGGGCCCAGGGTGTGGAATAACTGCGCCAGCTTCCTGTATATG
GATTACGACGCGACGAACCCGTCGTCGGATCCGCTCGATAACACGCGAGTTCACCCGGAGGACTACGAGCTCGGG
CGCAAGATGGCGGCCGACGCCTTGGAACTGGACGAGGAGGACGTCAAGGCCGAGACGGACGAGAACGGCCCCGGG
GCCATCGTGCGGAAGCTGTTTAAGCAGGACGAACAGGAGCGAGTCAACGAGCTGGTGCTTGACGAGTACGCGGAC
CAGCTGCTCAAGAACTTCAACCAGCGGAAGCGGGCGACGCTCGAGGCTATCAGCGCCGAGTTGCAAGCGCCATAC
GAGGAGCTTCGACGTAGCTTCTCGCCGCCGAACCCCTACGACGTCTTCACCATGTTCACGGGCGAGACCAAGAGT
TCGCTCTGTGAAGGTATGATTGTGCCGGTCAACGTACGCGTCGTACGCGACGATTTCGCCATCGTCAAGCTCGAC
TGCGGCATCGAGGGCCGGGTCGAGGCGCACGAGGTGACGAGCCGCGGGTCGGTCAAGGATGTGCTGAGCACGGGA
CAGACGGCGCAGGCCAAGATCCTGGAGATGAGCTACAAGGACATGGTGGCCAAGCTGTCGATGCGGGAAGAGTCG
CTCAGAATCCCGTACAAGCGGCCGACGAACCACGAGCGCGACTGGTGGGACTACGACCTCGAGAAGCAGGACAAG
GACGACCTCCAGGAAAAGGACAAGACGACGGGGCGGACGCAGCGTGTGGTGAAGCACCCCAACTTCAAGCCCTTC
AACTCGGTCCAGGCCGAGGAGTACCTGGGCTCTCAGCCGGCGGGCGAGGTGATTGTTCGGCCGTCGTCCAAGGGC
AACGACCACCTGGCGGTGACGTGGAAGGTGGCGGACAACGTGTACCAGCACATTGACGTGCTGGAGATGCTCAAG
GAGAACGAGTTCTCGGTCGGCAAGCTGCTGCGGGTCGGGGGCAAGTACACGTACAGCGACCTGGACGAGTTGATT
GTGGACCACGTCAAGGCCATGGCGAGAAAGGTAGAGGAGATGATGCGGCACGACAAGTTCCAGAAAATGTCCAAA
CCCGAGACGGAGAAGTGGTTGACGACGTACAGTGACGCCAACCCCAACCGGTCGACGTACGCCTTTTGTCTCGAC
ACGAAGCATCCGGGCTACTTCTGGCTGTGCTTCAAGGCGAGCCGGACGGCGCGGGTTATTGGACTGCCGGTACGG
TCGATCCCGCAGGGGTACGAGCTCCGAAACTACCAGTACCCGGACATGAGGGCGCTGTGCAACGGCTTCAAGCTG
CGGTATCAGAACGAGTTTTCCAAGATGGGCACGAAGTGA
Gene >Ophcf2|00963
ATGAGCAGTTCCATGCGCGACCTGATTTCGGCCGAGGCTGAGCTCGATGAAGAGGAAGACGAGTCTTTTGATGAA
GAAACCGGTCAGGAACGGAGACGGGCCAAAGGGCCCCGCTTCGAGGACTCTAGCGAAGAAGAAGAGGATGACGAT
GACGAGGAAGAAGCGCGCAAGGTAAGCGACCATCAGCATGATGATGCTTGTGCGGTTCGGGAGCTGACGCTTGGC
TTATCTAGGTCCGCGAGGGATTCATAGTTGACGAAGACGAAGAGGAAGATGAAGAGCAGGAGCAGGAGGAGAAAG
CCGGCTCCGATACCGAGGAACGTCACATAGTCAAGAGGAAGCGAGAGCACAGAGATCGCGAGGAAGAGGAGCGCC
TCGACGAAGAAGACTTGGAACTCATCGGCGAGCAGTTTGGTCCGCGTCCCAAGTCTCAGCCTCAGGTAAAGCTTT
TCCAAATTACTGATGTCAAGCCAGTGATGCTAACGTGTCCTCGCTGTAGTCAAAGTTCAAGCGCCTCAAACGTGG
TCATCGTGACGAGGACGAATCCGCAAACGAGCGTCGCGGGCTCGAGGAAATATTTTCTGATGAAGACGAAGATGC
CGGAGAACAGCGACCGTACGGCAGATCGAGCTTTCGTGCTCAAGCGGACGAGTTCGACGACTTCATCGAGGAAGA
CTTTCCCGAAGACGACGATGAGCGACTGCGGCAGCTCGAGGACGCCGAGGTGGCTCGCCCTAGGGATCGGGGCGT
CGGTGCCGTGGTCGATACATCCGGACTCGACAAGGATGCTCTCGACGACATGGAGGCCATCTTCGGCAATGGCGA
GGACTACGACTGGGCTCTTCAGCTCGAGGACGAAGAGGATGACCGCGAAAGGGAGGAGCAGGCCATTGAGCTCAA
AGACGTTTTCGAACCCTCCCAACTCAAGGAGAAGCTACTCACCGATGAGGACAACGAGATCAGGTTCACCGACGA
GCCCGAACGATTTCAACTGGACCGAAAGCCCTTCAAAAACCTCCAGCTTACGGCTGAGCAGTTTCGGGAGGAAGC
CAGGTGGATCACTGACCGCTTGCCAAAGAAGAGCTCGCAGGAACTTCAGGCCCCGTTCGTCAAGGCCGTCAGCAA
AGTGCTCGAGTTTTTCATCGTGGACGAAGTCGAGGTGCCCTACGTCTTTCAGCACCGCAAGGATTACCTCCTCCA
CTCCAAGAAGATTAGGAGGTCGACACGGGACGATCCAGATGGCCCGGACTACACCATCCAGTCAGACAAGCTTCT
GAACCAGGATGACCTGTGGAAAATTCTCGAGCTGGATATTCGGTTCCGTTCGTTTGTGGAAAAGAGAAACTCCAT
CGAAAAGACGCTCAAGTCGCTCGACGTCGACGACCCCATCCTTGCAGACATGATGCCGCAAGCAACGCAGATGGA
AGAACTCCAGGATCTGCAAGACTATCTGCATTTTCAATACAGTATCAAGCTGAAGGACTTGGCAGCCCTGTCTGG
CAACGCTTCGCTGACGAAACGACCCGGATCAAAGTCTTCGCTATTCGACCGCGTCCGTACTGGTCAAGCTTCAAA
ATTCGTTGAGGCGTACGGCATCTCGGCCGATCAGCTGGCCAAGAACGCACTCCGTCAGGGCAAAAAGGTTGTTCC
CGACGGGGACGACCAATATCCCTTGGATCTCGCCGACAGCCTGATCGACGACAGCTTCAACACGGGCGACCAGGT
CATGAACGCCGCCCGGCAGCTGTTTTCCGAGGAGCTGTTCGTGAGCCCGAGGCTGCGGAAGCACTTTCGCGCCTG
CTACTATCAAGGGGGCGAGATTAGCTGTCGACGGACGGATAAGGGGCTGCGCAAAATCGACGACTTGCACCCTTA
CTACGACATCAAGTACTTGCAGAACCGGCCGATTTCCGATTTCGCCGACCAACCCGAGCTGATCTTGAAGATGAT
GCGAGCCGAGGAGGAGGGCCTGGTCGAGGTCAAGGTCAACATGCCGCCTGAATACGAATTCCGTCGACAGCTGTA
CAAGGAGTTTAAATCGGACAACTACAGCGACCGGGCAGAACAGTGGAACCAGGAACGCAAGAAAGTGCTGGATCT
CGCGTTTCCTAAGCTTGAGAAGCTCATCGCCAAGAACTTCAAGGAGGTGGTCCGCACGTTTTGCCAGGACGAGGT
GCTCAAGAAGTGTCGGCAGGAATTTTACAGAAAGCTCGACCAGGCTCCGTATAAGCCCAAGGGTATGGTTCTGGG
CACGACGCCGCGCGTCTTGACGCTTTCGAACGGCATGGGGGACCCCTTCCGAGACCCGATATGCTGGGCCTGGGT
CGAGGAGGATGGCCGGGTTCTGGAGCAGGGAAAGTTTGGCAACCTCGCCAAGGACGAGGCGCAACGCGACGAGTT
TGTAGAGCTCGTCCAACGCCGCCGGCCCGATGTGATTGGCGTGAGCGGCTGGTGCGCCGACACCAACAGGCTGGT
GCGCGACCTGGAGAACCTGGTGAGCGAAAAGGGGCTCATGGGCCCCGAGTTCGACGATCCCGAGACCAACGACTA
CCGCGCCGAGCCGCTCGAGGTGGTGGTGGTGGACGACGAGGTGGCCAGGCTGTACAAGGACAGCCCGCGCGCCGT
GGCAGAGCATCCGTCGCTCAACCCCGTCACGCGATACTGCATCGCCCTGGCTCGATACATGCAGAACCCTCTCAA
GGAGTACGCGGCCCTGGGCAGAGACATTGGGTCGCTGTCGTACCACCCGTGCCAGCAACTGCTGCCGCAGGACAA
GCTGATGAAGTATCTGGAGTCGGCCATGGTGGACACGGTCAACATGGTGGGCGTCAACATCAACGACGCCATGAC
GGACCCGTACACGGCAAACCTGCTGCCGTACGTGGCCGGGCTTGGGCCGCGGAAGGCGACGAGCGTTGTTAAGGC
CATCAATGCCAACGGAGGCTCCGTCAACACCAGGGACGAGCTCGTGGGCGACCCGGACAGCGGCAAGCTGCCAGT
GGTTGGGCCCAGGGTGTGGAATAACTGCGCCAGCTTCCTGTATATGGATTACGACGCGACGAACCCGTCGTCGGA
TCCGCTCGATAACACGCGAGTTCACCCGGAGGACTACGAGCTCGGGCGCAAGATGGCGGCCGACGCCTTGGAACT
GGACGAGGAGGACGTCAAGGCCGAGACGGACGAGAACGGCCCCGGGGCCATCGTGCGGAAGCTGTTTAAGCAGGA
CGAACAGGAGCGAGTCAACGAGCTGGTGCTTGACGAGTACGCGGACCAGCTGCTCAAGAACTTCAACCAGCGGAA
GCGGGCGACGCTCGAGGCTATCAGCGCCGAGTTGCAAGCGCCATACGAGGAGCTTCGACGTAGCTTCTCGCCGCC
GAACCCCTACGACGTCTTCACCATGTTCACGGGCGAGACCAAGAGTTCGCTCTGTGAAGGTATGATTGTGCCGGT
CAACGTACGCGTCGTACGCGACGATTTCGCCATCGTCAAGCTCGACTGCGGCATCGAGGGCCGGGTCGAGGCGCA
CGAGGTGACGAGCCGCGGGTCGGTCAAGGATGTGCTGAGCACGGGACAGACGGCGCAGGCCAAGATCCTGGAGAT
GAGCTACAAGGACATGGTGGCCAAGCTGTCGATGCGGGAAGAGTCGCTCAGAATCCCGTACAAGCGGCCGACGAA
CCACGAGCGCGACTGGTGGGACTACGACCTCGAGAAGCAGGACAAGGACGACCTCCAGGAAAAGGACAAGACGAC
GGGGCGGACGCAGCGTGTGGTGAAGCACCCCAACTTCAAGCCCTTCAACTCGGTCCAGGCCGAGGAGTACCTGGG
CTCTCAGCCGGCGGGCGAGGTGATTGTTCGGCCGTCGTCCAAGGGCAACGACCACCTGGCGGTGACGTGGAAGGT
GGCGGACAACGTGTACCAGCACATTGACGTGCTGGAGATGCTCAAGGAGAACGAGTTCTCGGTCGGCAAGCTGCT
GCGGGTCGGGGGCAAGTACACGTACAGCGACCTGGACGAGTTGATTGTGGACCACGTCAAGGCCATGGCGAGAAA
GGTAGAGGAGATGATGCGGCACGACAAGTTCCAGAAAATGTCCAAACCCGAGACGGGTGAGTTGTCTCTTTTTCA
TCTCTGTGTTTTTGTTTTTGTCGAGCAGATGCTAACAGGAGGGGCGGAAACAGAGAAGTGGTTGACGACGTACAG
TGACGCCAACCCCAACCGGTCGACGTACGCCTTTTGTCTCGACACGAAGCATCCGGGCTACTTCTGGCTGTGCTT
CAAGGCGAGCCGGACGGCGCGGGTTATTGGACTGCCGGTACGGTCGATCCCGCAGGGGTACGAGCTCCGAAACTA
CCAGTACCCGGACATGAGGGCGCTGTGCAACGGCTTCAAGCTGCGGTATCAGAACGAGTTTTCCAAGATGGGCAC
GAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail