Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00961
Gene name
Locationscaffold_01:3679145..3679831
Strand-
Gene length (bp)686
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05700 BCAS2 Breast carcinoma amplified sequence 2 (BCAS2) 6.9E-28 17 142

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0016071 mRNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6255 0.6387 0.0934 0.0808 0.2857 0.0049 0.0407 0.1074 0.0449 0.1086

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|7718
Ophiocordyceps camponoti-floridani Ophcf2|00961 (this protein)
Ophiocordyceps kimflemingae Ophio5|1034

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00961
MNEPPAHDSLPLGSRHPLPLSRYEAQEPPREGRVRPALEAAYVSAVYLDARTRNLRLLEENGARAWLLHNHRLEG
LVAGLEARRDAVAADIDVVNAARRDGQKAAEAELDALEGEWKREIGRVLETEMDVCRLEAEVRRRRRVVAAAAMG
QQSETPR*
Coding >Ophcf2|00961
ATGAACGAACCTCCAGCCCACGACTCCCTCCCTCTCGGAAGCCGGCATCCCCTCCCCCTCTCCCGGTACGAAGCG
CAGGAGCCGCCCCGCGAGGGCCGGGTCCGCCCCGCGCTGGAGGCGGCCTACGTGTCGGCCGTCTACCTCGATGCC
CGGACGCGGAACCTCCGGCTGCTGGAGGAGAATGGCGCGCGGGCCTGGCTCCTGCATAATCATCGGCTCGAGGGC
TTGGTGGCTGGGCTCGAGGCGCGGAGGGATGCCGTTGCTGCGGATATAGACGTCGTCAATGCGGCGAGGAGGGAT
GGGCAGAAGGCTGCCGAGGCGGAGCTTGATGCGCTGGAGGGGGAGTGGAAGAGGGAGATTGGGAGGGTGCTGGAG
ACGGAGATGGATGTTTGTCGGCTGGAGGCTGAGGTTAGGAGGAGGAGACGGGTGGTGGCTGCTGCTGCTATGGGA
CAACAGTCGGAGACACCGAGGTGA
Transcript >Ophcf2|00961
ATGAACGAACCTCCAGCCCACGACTCCCTCCCTCTCGGAAGCCGGCATCCCCTCCCCCTCTCCCGGTACGAAGCG
CAGGAGCCGCCCCGCGAGGGCCGGGTCCGCCCCGCGCTGGAGGCGGCCTACGTGTCGGCCGTCTACCTCGATGCC
CGGACGCGGAACCTCCGGCTGCTGGAGGAGAATGGCGCGCGGGCCTGGCTCCTGCATAATCATCGGCTCGAGGGC
TTGGTGGCTGGGCTCGAGGCGCGGAGGGATGCCGTTGCTGCGGATATAGACGTCGTCAATGCGGCGAGGAGGGAT
GGGCAGAAGGCTGCCGAGGCGGAGCTTGATGCGCTGGAGGGGGAGTGGAAGAGGGAGATTGGGAGGGTGCTGGAG
ACGGAGATGGATGTTTGTCGGCTGGAGGCTGAGGTTAGGAGGAGGAGACGGGTGGTGGCTGCTGCTGCTATGGGA
CAACAGTCGGAGACACCGAGGTGA
Gene >Ophcf2|00961
ATGAACGAACCTCCAGCCCACGACTCCCTCCCTGTACGCAAAATCCCCCCCCCCCCCCCAAAAAAAAACTAACCA
CCAACTGACTCCCAACCCCCAGACATCGACCCCCCCCTCCCCCGATTCCCTCGCCCACGCAACCAAGCTCATAAC
CACCGAACAGCAATCCCTCCCCGCCCCAACCCTCCGCCCGATCCCCCCCCAACCTTCACCCCCGCCCAAGCCACG
CAACTCTCCCGCATCGCCAGCTCGGAAGCCGGCATCCCCTCCCCCTCTCCCGGTACGAAGCGCAGGAGCCGCCCC
GCGAGGGCCGGGTCCGCCCCGCGCTGGAGGCGGCCTACGTGTCGGCCGTCTACCTCGATGCCCGGACGCGGAACC
TCCGGCTGCTGGAGGAGAATGGCGCGCGGGCCTGGCTCCTGCATAATCATCGGCTCGAGGGCTTGGTGGCTGGGC
TCGAGGCGCGGAGGGATGCCGTTGCTGCGGATATAGACGTCGTCAATGCGGCGAGGAGGGATGGGCAGAAGGCTG
CCGAGGCGGAGCTTGATGCGCTGGAGGGGGAGTGGAAGAGGGAGATTGGGAGGGTGCTGGAGACGGAGATGGATG
TTTGTCGGCTGGAGGCTGAGGTTAGGAGGAGGAGACGGGTGGTGGCTGCTGCTGCTATGGGACAACAGTCGGAGA
CACCGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail