Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00950
Gene name
Locationscaffold_01:3646838..3650436
Strand+
Gene length (bp)3598
Transcript length (bp)3351
Coding sequence length (bp)3351
Protein length (aa) 1117

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 2.2E-82 190 464
PF09111 SLIDE SLIDE 5.8E-44 914 1029
PF09110 HAND HAND 6.4E-34 752 856
PF00271 Helicase_C Helicase conserved C-terminal domain 1.0E-16 488 599
PF04851 ResIII Type III restriction enzyme, res subunit 1.2E-09 180 340

GO

GO Term Description Terminal node
GO:0031491 nucleosome binding Yes
GO:0005634 nucleus Yes
GO:0016787 hydrolase activity Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0006338 chromatin remodeling Yes
GO:0005524 ATP binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0044877 protein-containing complex binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0043226 organelle No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0003682 chromatin binding No
GO:0003676 nucleic acid binding No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0043227 membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016043 cellular component organization No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0005575 cellular_component No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0006325 chromatin organization No
GO:0043229 intracellular organelle No
GO:0140657 ATP-dependent activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1774 0.8996 0.0473 0.0202 0.0513 0.0084 0.029 0.0074 0.0194 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1495
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2414
Ophiocordyceps australis map64 (Brazil) OphauB2|7738
Ophiocordyceps camponoti-floridani Ophcf2|00950 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4536
Ophiocordyceps kimflemingae Ophio5|2152
Ophiocordyceps subramaniannii Hirsu2|1114

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00950
MAPRPRASGVHTDASMSDAPENPPAEEMVDETPDCSDSDTNPNTTASSVVGEATNEGRKRRTEANQLRRSIFGKK
HDRLGESKEDDTIRRFRYLLGLTDLFRHFIETNPDPKIREIMAEIDRQNAEASRAKKGAGRQGGATSERRRRTEA
EEDAELLKDEKRGGAADTVFRESPAFIQGTMRDYQIAGLNWLISLHENGISGILADEMGLGKTLQTISFLGYLRH
IAGITGPHLITVPKSTLDNWQREFARWTPEVNVLVLQGAKDERHNLINERLVDEKFDVCITSYEMILREKSHLKK
FAWEYIIIDEAHRIKNEESSLSQVIRLFSSRNRLLITGTPLQNNLHELWALLNFLLPDVFGDAEAFDQWFSGQDR
DQDTVVQQLHRVLRPFLLRRVKSDVEKSLLPKKEVNLYLGMSDMQVKWYQKILEKDIDAVNGAGGKRESKTRLLN
IVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVYNAGKMVVLDKLLARLQAQGSRVLIFSQMSRLLDILEDYCVFRQ
YKYCRIDGGTAHEDRIAAIDEYNKPGSDRFVFLLTTRAGGLGINLTTADIVILYDSDWNPQADLQAQDRAHRIGQ
TKQVVVYRFVTDNAIEEKVLERAAQKLRLDQLVIQQGRAQIAAKAAANKDELLSMIQHGAEKVFQSKAGTSGTDS
NGAGAKDCDIDEILSRGENRTKELNSKYEKLGIDDLQKFTSESAYEWNGENFANVKKDISLNWINPAKRERKEQS
YSMDKYFRQAMFPNPKADTKPKAPRAPKQVPVHDYQFYPERLRHLQDRETAYYRKEIGYKIPLPDGGDDDLSDRE
ATRALEQKEIDDSTPLTEDERLEKEELSNQGFSHWNKRDFQQFINGSGKYGRTAYAGIAHEVDSKTPAEIKAYAK
VFWQRYEEIADWAKYIKVIEDGEERTRRVENQRKLLRKKMQQYRVPLQQLKINYSVSTTNKKVYTEEEDRFLLVL
LDKYGIDSEGLYDKMRDDIRESPLFRFDWFFLSRTPTELSRRCTTLITTIVKEFEDVPVRGANGVNGKLKRELDE
DNDEDSVLGMAPAKKKSKNGVKNKALDNVKSSKASSTSPSRASSVASTPSNAGGSAKGKKGKARRR*
Coding >Ophcf2|00950
ATGGCTCCACGGCCCCGGGCCAGTGGCGTCCATACCGACGCCTCCATGTCAGACGCGCCAGAGAATCCCCCGGCG
GAAGAAATGGTGGACGAGACGCCGGACTGTTCCGACTCGGACACGAACCCCAACACGACGGCCAGCAGCGTCGTT
GGCGAGGCCACGAATGAGGGTCGCAAGCGTCGTACTGAGGCTAACCAGCTGCGTCGGAGCATCTTTGGAAAGAAG
CATGACCGTCTCGGCGAGTCCAAGGAGGACGATACCATTCGTCGGTTTCGATATCTCCTCGGTCTCACAGATCTG
TTTCGACACTTTATCGAGACAAATCCTGATCCCAAGATCCGCGAGATCATGGCTGAAATCGATCGCCAAAATGCG
GAGGCGTCTCGGGCCAAGAAGGGCGCCGGTCGTCAGGGTGGCGCGACTAGTGAGAGACGTCGCCGCACCGAGGCG
GAGGAGGACGCCGAGCTTCTCAAGGATGAGAAGCGTGGAGGTGCGGCCGATACCGTCTTTAGGGAGTCGCCGGCC
TTCATCCAGGGCACCATGAGGGACTATCAGATCGCCGGCTTGAACTGGCTCATCTCGCTACACGAGAACGGTATA
TCGGGCATTCTCGCCGACGAGATGGGCCTCGGCAAGACGCTCCAGACCATCTCGTTCCTAGGCTACCTCCGACAT
ATTGCCGGCATTACCGGTCCTCACCTCATCACCGTGCCCAAGTCTACGCTCGACAACTGGCAGCGCGAGTTTGCC
AGGTGGACGCCCGAGGTCAATGTCTTGGTCCTACAGGGCGCCAAGGACGAGCGGCACAACCTCATCAATGAGCGT
CTCGTTGACGAAAAGTTTGATGTCTGCATCACTAGTTACGAGATGATTCTGCGTGAAAAGTCACACCTGAAGAAG
TTTGCATGGGAGTATATAATTATCGACGAGGCCCACCGCATCAAGAACGAGGAGTCTTCTCTTTCGCAGGTCATC
CGGCTCTTCTCGTCGCGCAACAGGCTCCTGATCACGGGCACGCCGCTGCAGAACAACCTGCACGAGCTGTGGGCT
CTCCTCAACTTCCTACTGCCCGACGTCTTTGGCGATGCAGAGGCCTTTGACCAGTGGTTCTCAGGCCAGGACCGA
GACCAGGACACGGTCGTTCAGCAGCTTCACCGCGTCTTGCGCCCGTTTTTGCTGCGAAGGGTCAAGAGTGATGTG
GAGAAGAGCTTGTTGCCCAAGAAGGAGGTGAACCTATACCTTGGCATGTCTGACATGCAGGTCAAGTGGTACCAG
AAGATACTGGAGAAGGACATTGACGCCGTCAACGGTGCTGGCGGGAAGCGAGAGTCCAAGACGAGGCTTCTGAAC
ATTGTGATGCAGCTGCGCAAGTGCTGCAACCACCCCTACCTCTTCGAAGGCGCCGAGCCTGGGCCCCCGTACACG
ACCGATGAGCATCTCGTGTACAACGCCGGCAAGATGGTCGTTCTCGACAAGCTCTTGGCCAGGCTGCAGGCGCAG
GGGAGCAGGGTTCTCATCTTCTCTCAGATGAGCCGACTGTTGGACATTTTGGAGGATTACTGCGTCTTCCGACAG
TACAAGTATTGCCGAATCGACGGCGGGACGGCCCACGAGGATCGTATCGCCGCCATTGACGAGTACAACAAGCCC
GGGTCGGACCGCTTCGTCTTCCTGCTCACCACCAGGGCCGGAGGTCTGGGCATCAACCTGACGACGGCCGACATC
GTCATCCTGTACGATAGCGACTGGAACCCGCAGGCGGATCTCCAGGCTCAGGACCGCGCTCACCGCATCGGGCAA
ACGAAGCAGGTGGTGGTGTACCGGTTCGTCACCGACAACGCCATCGAGGAAAAGGTCCTGGAGCGAGCCGCTCAG
AAGCTCCGCCTCGATCAGCTCGTTATCCAGCAGGGCCGAGCGCAGATCGCCGCCAAGGCCGCTGCAAACAAGGAC
GAGCTCCTATCAATGATACAGCACGGGGCCGAGAAGGTGTTCCAGTCCAAGGCCGGCACGAGCGGCACCGACAGC
AACGGCGCCGGAGCCAAGGACTGCGACATTGACGAGATCCTCTCGCGGGGCGAGAACCGCACCAAAGAGCTCAAT
TCCAAGTACGAGAAGCTGGGCATCGACGACCTGCAGAAATTCACGTCCGAGTCGGCCTACGAGTGGAATGGCGAG
AACTTTGCCAATGTCAAGAAGGACATAAGCTTGAACTGGATCAATCCGGCCAAGCGGGAGCGCAAGGAACAGTCT
TACTCGATGGACAAGTACTTTAGGCAGGCCATGTTTCCCAACCCCAAGGCCGACACAAAGCCCAAGGCTCCCCGG
GCGCCGAAGCAGGTGCCCGTCCACGACTATCAATTCTATCCCGAACGCCTGCGCCATCTTCAAGACAGGGAGACG
GCCTACTACCGGAAGGAGATTGGGTATAAGATTCCCCTCCCCGATGGCGGCGATGACGACCTGTCGGATCGCGAG
GCCACGCGGGCGCTCGAGCAGAAGGAGATTGACGACTCGACGCCGCTGACCGAGGATGAGCGGCTCGAGAAGGAA
GAGCTCTCGAATCAGGGCTTCAGCCACTGGAACAAACGCGACTTTCAGCAGTTCATCAACGGATCGGGTAAATAC
GGGCGCACGGCGTACGCGGGCATCGCGCACGAGGTCGATAGCAAGACGCCGGCCGAGATCAAGGCGTATGCCAAG
GTGTTTTGGCAACGATACGAGGAGATTGCCGACTGGGCCAAGTACATCAAGGTCATCGAGGACGGCGAGGAGCGG
ACGAGGCGAGTCGAGAACCAGCGAAAGCTGCTGCGGAAGAAGATGCAGCAGTATCGCGTTCCGCTGCAGCAGCTC
AAGATCAACTACTCCGTCTCCACGACCAACAAGAAGGTGTACACAGAGGAGGAGGACCGCTTCCTGCTGGTGCTG
CTGGATAAGTACGGCATCGACTCGGAGGGCCTGTACGACAAGATGAGAGACGACATCCGCGAGTCGCCCCTGTTT
CGCTTCGACTGGTTCTTCCTCAGCCGGACGCCGACTGAGCTGTCACGTCGGTGCACGACGCTCATCACCACCATC
GTCAAAGAGTTCGAGGACGTGCCTGTCAGGGGCGCCAACGGCGTCAACGGCAAGCTGAAGCGCGAGCTCGACGAG
GACAATGACGAGGACAGCGTGCTGGGCATGGCGCCGGCCAAGAAGAAGTCGAAGAACGGTGTCAAGAATAAGGCT
CTTGACAATGTGAAATCGAGCAAGGCCAGTTCCACCTCGCCGTCCAGGGCCTCGAGCGTCGCCTCCACGCCCTCC
AACGCTGGTGGGTCGGCAAAGGGGAAGAAGGGCAAGGCGAGGAGGAGGTGA
Transcript >Ophcf2|00950
ATGGCTCCACGGCCCCGGGCCAGTGGCGTCCATACCGACGCCTCCATGTCAGACGCGCCAGAGAATCCCCCGGCG
GAAGAAATGGTGGACGAGACGCCGGACTGTTCCGACTCGGACACGAACCCCAACACGACGGCCAGCAGCGTCGTT
GGCGAGGCCACGAATGAGGGTCGCAAGCGTCGTACTGAGGCTAACCAGCTGCGTCGGAGCATCTTTGGAAAGAAG
CATGACCGTCTCGGCGAGTCCAAGGAGGACGATACCATTCGTCGGTTTCGATATCTCCTCGGTCTCACAGATCTG
TTTCGACACTTTATCGAGACAAATCCTGATCCCAAGATCCGCGAGATCATGGCTGAAATCGATCGCCAAAATGCG
GAGGCGTCTCGGGCCAAGAAGGGCGCCGGTCGTCAGGGTGGCGCGACTAGTGAGAGACGTCGCCGCACCGAGGCG
GAGGAGGACGCCGAGCTTCTCAAGGATGAGAAGCGTGGAGGTGCGGCCGATACCGTCTTTAGGGAGTCGCCGGCC
TTCATCCAGGGCACCATGAGGGACTATCAGATCGCCGGCTTGAACTGGCTCATCTCGCTACACGAGAACGGTATA
TCGGGCATTCTCGCCGACGAGATGGGCCTCGGCAAGACGCTCCAGACCATCTCGTTCCTAGGCTACCTCCGACAT
ATTGCCGGCATTACCGGTCCTCACCTCATCACCGTGCCCAAGTCTACGCTCGACAACTGGCAGCGCGAGTTTGCC
AGGTGGACGCCCGAGGTCAATGTCTTGGTCCTACAGGGCGCCAAGGACGAGCGGCACAACCTCATCAATGAGCGT
CTCGTTGACGAAAAGTTTGATGTCTGCATCACTAGTTACGAGATGATTCTGCGTGAAAAGTCACACCTGAAGAAG
TTTGCATGGGAGTATATAATTATCGACGAGGCCCACCGCATCAAGAACGAGGAGTCTTCTCTTTCGCAGGTCATC
CGGCTCTTCTCGTCGCGCAACAGGCTCCTGATCACGGGCACGCCGCTGCAGAACAACCTGCACGAGCTGTGGGCT
CTCCTCAACTTCCTACTGCCCGACGTCTTTGGCGATGCAGAGGCCTTTGACCAGTGGTTCTCAGGCCAGGACCGA
GACCAGGACACGGTCGTTCAGCAGCTTCACCGCGTCTTGCGCCCGTTTTTGCTGCGAAGGGTCAAGAGTGATGTG
GAGAAGAGCTTGTTGCCCAAGAAGGAGGTGAACCTATACCTTGGCATGTCTGACATGCAGGTCAAGTGGTACCAG
AAGATACTGGAGAAGGACATTGACGCCGTCAACGGTGCTGGCGGGAAGCGAGAGTCCAAGACGAGGCTTCTGAAC
ATTGTGATGCAGCTGCGCAAGTGCTGCAACCACCCCTACCTCTTCGAAGGCGCCGAGCCTGGGCCCCCGTACACG
ACCGATGAGCATCTCGTGTACAACGCCGGCAAGATGGTCGTTCTCGACAAGCTCTTGGCCAGGCTGCAGGCGCAG
GGGAGCAGGGTTCTCATCTTCTCTCAGATGAGCCGACTGTTGGACATTTTGGAGGATTACTGCGTCTTCCGACAG
TACAAGTATTGCCGAATCGACGGCGGGACGGCCCACGAGGATCGTATCGCCGCCATTGACGAGTACAACAAGCCC
GGGTCGGACCGCTTCGTCTTCCTGCTCACCACCAGGGCCGGAGGTCTGGGCATCAACCTGACGACGGCCGACATC
GTCATCCTGTACGATAGCGACTGGAACCCGCAGGCGGATCTCCAGGCTCAGGACCGCGCTCACCGCATCGGGCAA
ACGAAGCAGGTGGTGGTGTACCGGTTCGTCACCGACAACGCCATCGAGGAAAAGGTCCTGGAGCGAGCCGCTCAG
AAGCTCCGCCTCGATCAGCTCGTTATCCAGCAGGGCCGAGCGCAGATCGCCGCCAAGGCCGCTGCAAACAAGGAC
GAGCTCCTATCAATGATACAGCACGGGGCCGAGAAGGTGTTCCAGTCCAAGGCCGGCACGAGCGGCACCGACAGC
AACGGCGCCGGAGCCAAGGACTGCGACATTGACGAGATCCTCTCGCGGGGCGAGAACCGCACCAAAGAGCTCAAT
TCCAAGTACGAGAAGCTGGGCATCGACGACCTGCAGAAATTCACGTCCGAGTCGGCCTACGAGTGGAATGGCGAG
AACTTTGCCAATGTCAAGAAGGACATAAGCTTGAACTGGATCAATCCGGCCAAGCGGGAGCGCAAGGAACAGTCT
TACTCGATGGACAAGTACTTTAGGCAGGCCATGTTTCCCAACCCCAAGGCCGACACAAAGCCCAAGGCTCCCCGG
GCGCCGAAGCAGGTGCCCGTCCACGACTATCAATTCTATCCCGAACGCCTGCGCCATCTTCAAGACAGGGAGACG
GCCTACTACCGGAAGGAGATTGGGTATAAGATTCCCCTCCCCGATGGCGGCGATGACGACCTGTCGGATCGCGAG
GCCACGCGGGCGCTCGAGCAGAAGGAGATTGACGACTCGACGCCGCTGACCGAGGATGAGCGGCTCGAGAAGGAA
GAGCTCTCGAATCAGGGCTTCAGCCACTGGAACAAACGCGACTTTCAGCAGTTCATCAACGGATCGGGTAAATAC
GGGCGCACGGCGTACGCGGGCATCGCGCACGAGGTCGATAGCAAGACGCCGGCCGAGATCAAGGCGTATGCCAAG
GTGTTTTGGCAACGATACGAGGAGATTGCCGACTGGGCCAAGTACATCAAGGTCATCGAGGACGGCGAGGAGCGG
ACGAGGCGAGTCGAGAACCAGCGAAAGCTGCTGCGGAAGAAGATGCAGCAGTATCGCGTTCCGCTGCAGCAGCTC
AAGATCAACTACTCCGTCTCCACGACCAACAAGAAGGTGTACACAGAGGAGGAGGACCGCTTCCTGCTGGTGCTG
CTGGATAAGTACGGCATCGACTCGGAGGGCCTGTACGACAAGATGAGAGACGACATCCGCGAGTCGCCCCTGTTT
CGCTTCGACTGGTTCTTCCTCAGCCGGACGCCGACTGAGCTGTCACGTCGGTGCACGACGCTCATCACCACCATC
GTCAAAGAGTTCGAGGACGTGCCTGTCAGGGGCGCCAACGGCGTCAACGGCAAGCTGAAGCGCGAGCTCGACGAG
GACAATGACGAGGACAGCGTGCTGGGCATGGCGCCGGCCAAGAAGAAGTCGAAGAACGGTGTCAAGAATAAGGCT
CTTGACAATGTGAAATCGAGCAAGGCCAGTTCCACCTCGCCGTCCAGGGCCTCGAGCGTCGCCTCCACGCCCTCC
AACGCTGGTGGGTCGGCAAAGGGGAAGAAGGGCAAGGCGAGGAGGAGGTGA
Gene >Ophcf2|00950
ATGGCTCCACGGCCCCGGGCCAGTGGCGTCCATACCGACGCCTCCATGTCAGACGCGCCAGAGAATCCCCCGGCG
GAAGAAATGGTAGGCTGCTTCGGCCGGACCGTTCATGGCTTCTGCTGTGCTGACCCTTTGGTTAGGTGGACGAGA
CGCCGGACTGTTCCGACTCGGACACGAACCCCAACACGACGGCCAGCAGCGTCGTTGGCGAGGCCACGAATGAGG
GTCGCAAGCGTCGTACTGAGGCTAACCAGCTGCGTCGGAGCATCTTTGGAAAGAAGCATGACCGTCTCGGCGAGT
CCAAGGTTTGCATACCCCTCGTACAAATTGCTGCGGGCGTTGAAGCTGACGCTGGCCGCGTGCAGGAGGACGATA
CCATTCGTCGGTTTCGATATCTCCTCGGTCTCACAGATCTGTTTCGACACTTTATCGAGACAAATCCTGATCCCA
AGATCCGCGAGATCATGGCTGAAATCGATCGCCAAAATGCGGAGGCGTCTCGGGCCAAGAAGGGCGCCGGTCGTC
AGGGTGGCGCGACTAGTGAGAGACGTCGCCGCACCGAGGCGGAGGAGGACGCCGAGCTTCTCAAGGATGAGAAGC
GTGGAGGTGCGGCCGATACCGTCTTTAGGGAGTCGCCGGCCTTCATCCAGGGCACCATGAGGGACTATCAGATCG
CCGGCTTGAACTGGCTCATCTCGCTACACGAGAACGGTATATCGGGCATTCTCGCCGACGAGATGGGCCTCGGCA
AGACGCTCCAGACCATCTCGTTCCTAGGCTACCTCCGACATATTGCCGGCATTACCGGTCCTCACCTCATCACCG
TGCCCAAGTCTACGCTCGACAACTGGCAGCGCGAGTTTGCCAGGTGGACGCCCGAGGTCAATGTCTTGGTCCTAC
AGGGCGCCAAGGACGAGCGGCACAACCTCATCAATGAGCGTCTCGTTGACGAAAAGTTTGATGTCTGCATCACTA
GTTACGAGATGATTCTGCGTGAAAAGTCACACCTGAAGAAGTTTGCATGGGAGTATATAATTATCGACGAGGTGA
GTCTTTGAATTGGCTGATATTCACCGAGATCTATATAGGTACTGATGCCGCACCACAGGCCCACCGCATCAAGAA
CGAGGAGTCTTCTCTTTCGCAGGTCATCCGGCTCTTCTCGTCGCGCAACAGGCTCCTGATCACGGGCACGCCGCT
GCAGAACAACCTGCACGAGCTGTGGGCTCTCCTCAACTTCCTACTGCCCGACGTCTTTGGCGATGCAGAGGCCTT
TGACCAGTGGTTCTCAGGCCAGGACCGAGACCAGGACACGGTCGTTCAGCAGCTTCACCGCGTCTTGCGCCCGTT
TTTGCTGCGAAGGGTCAAGAGTGATGTGGAGAAGAGCTTGTTGCCCAAGAAGGAGGTGAACCTATACCTTGGCAT
GTCTGACATGCAGGTCAAGTGGTACCAGAAGATACTGGAGAAGGACATTGACGCCGTCAACGGTGCTGGCGGGAA
GCGAGAGTCCAAGACGAGGCTTCTGAACATTGTGATGCAGCTGCGCAAGTGCTGCAACCACCCCTACCTCTTCGA
AGGCGCCGAGCCTGGGCCCCCGTACACGACCGATGAGCATCTCGTGTACAACGCCGGCAAGATGGTCGTTCTCGA
CAAGCTCTTGGCCAGGCTGCAGGCGCAGGGGAGCAGGGTTCTCATCTTCTCTCAGATGAGCCGACTGTTGGACAT
TTTGGAGGATTACTGCGTCTTCCGACAGTACAAGTATTGCCGAATCGACGGCGGGACGGCCCACGAGGATCGTAT
CGCCGCCATTGACGAGTACAACAAGCCCGGGTCGGACCGCTTCGTCTTCCTGCTCACCACCAGGGCCGGAGGTCT
GGGCATCAACCTGACGACGGCCGACATCGTCATCCTGTACGATAGCGACTGGAACCCGCAGGCGGATCTCCAGGC
TCAGGACCGCGCTCACCGCATCGGGCAAACGAAGCAGGTGGTGGTGTACCGGTTCGTCACCGACAACGCCATCGA
GGAAAAGGTCCTGGAGCGAGCCGCTCAGAAGCTCCGCCTCGATCAGCTCGTTATCCAGCAGGGCCGAGCGCAGAT
CGCCGCCAAGGCCGCTGCAAACAAGGACGAGCTCCTATCAATGATACAGCACGGGGCCGAGAAGGTGTTCCAGTC
CAAGGCCGGCACGAGCGGCACCGACAGCAACGGCGCCGGAGCCAAGGACTGCGACATTGACGAGATCCTCTCGCG
GGGCGAGAACCGCACCAAAGAGCTCAATTCCAAGTACGAGAAGCTGGGCATCGACGACCTGCAGAAATTCACGTC
CGAGTCGGCCTACGAGTGGAATGGCGAGAACTTTGCCAATGTCAAGAAGGACATAAGCTTGAACTGGATCAATCC
GGCCAAGCGGGAGCGCAAGGAACAGTCTTACTCGATGGACAAGTACTTTAGGCAGGCCATGTTTCCCAACCCCAA
GGCCGACACAAAGCCCAAGGCTCCCCGGGCGCCGAAGCAGGTGCCCGTCCACGACTATCAATTCTATCCCGAACG
CCTGCGCCATCTTCAAGACAGGGAGACGGCCTACTACCGGAAGGAGATTGGGTATAAGATTCCCCTCCCCGATGG
CGGCGATGACGACCTGTCGGATCGCGAGGCCACGCGGGCGCTCGAGCAGAAGGAGATTGACGACTCGACGCCGCT
GACCGAGGATGAGCGGCTCGAGAAGGAAGAGCTCTCGAATCAGGGCTTCAGCCACTGGAACAAACGCGACTTTCA
GCAGTTCATCAACGGATCGGGTAAATACGGGCGCACGGCGTACGCGGGCATCGCGCACGAGGTCGATAGCAAGAC
GCCGGCCGAGATCAAGGCGTATGCCAAGGTGTTTTGGCAACGATACGAGGAGATTGCCGACTGGGCCAAGTACAT
CAAGGTCATCGAGGACGGCGAGGAGCGGACGAGGCGAGTCGAGAACCAGCGAAAGCTGCTGCGGAAGAAGATGCA
GCAGTATCGCGTTCCGCTGCAGCAGCTCAAGATCAACTACTCCGTCTCCACGACCAACAAGAAGGTGTACACAGA
GGAGGAGGACCGCTTCCTGCTGGTGCTGCTGGATAAGTACGGCATCGACTCGGAGGGCCTGTACGACAAGATGAG
AGACGACATCCGCGAGTCGCCCCTGTTTCGCTTCGACTGGTTCTTCCTCAGCCGGACGCCGACTGAGCTGTCACG
TCGGTGCACGACGCTCATCACCACCATCGTCAAAGAGTTCGAGGACGTGCCTGTCAGGGGCGCCAACGGCGTCAA
CGGCAAGCTGAAGCGCGAGCTCGACGAGGACAATGACGAGGACAGCGTGCTGGGCATGGCGCCGGCCAAGAAGAA
GTCGAAGAACGGTGTCAAGGTTGGTCTCACCATGCGTCCGACCGAGCTCCCAATTTCTATCGCCTTTCTAACTCC
CGAGACCTCACAGAATAAGGCTCTTGACAATGTGAAATCGAGCAAGGCCAGTTCCACCTCGCCGTCCAGGGCCTC
GAGCGTCGCCTCCACGCCCTCCAACGCTGGTGGGTCGGCAAAGGGGAAGAAGGGCAAGGCGAGGAGGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail