Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00946
Gene name
Locationscaffold_01:3636231..3636928
Strand-
Gene length (bp)697
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 55 74 19
2 87 109 22
3 119 141 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 62.78 30.96 94.59
Alive In ants, during behavior modification 48.07 16.13 80.00
Dead In ants, recently dead 32.52 13.49 51.54

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.311360 no
Alive Dead 0.093144 no
Dead Fungus 0.004376 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00946
MPDSGTASAPLLPSHARRSDGLSSSAPASGSDLSHRLKRMRAAAASGLSSRRKHFAIMAVVGVDVFALLVEVFIR
LIACETGQGREAWVVITTSVLGTVGLVISCLFMVELMACLLVYGFGYLCSWFHLFDALVIVISFIVDVGLRGVAG
SIGSLVVVLRLWRLAKLSEEVVLGASERMDLLERHLDEIERENKQLRVQLGVEAGHRSSRG*
Coding >Ophcf2|00946
ATGCCCGACTCCGGCACCGCCTCAGCCCCTCTCCTACCGTCTCACGCCCGCCGCTCCGATGGGCTGTCGTCCTCG
GCGCCGGCTTCGGGCTCGGATCTGAGCCACCGCCTGAAGCGAATGCGTGCGGCGGCTGCGAGTGGTCTCTCATCG
CGCCGCAAGCACTTTGCCATCATGGCCGTTGTCGGCGTCGACGTCTTCGCACTGCTAGTCGAAGTCTTTATCCGG
CTCATTGCTTGCGAGACGGGACAGGGCCGTGAGGCATGGGTGGTAATTACCACTTCTGTACTCGGCACTGTCGGT
CTGGTTATCAGCTGCCTCTTCATGGTCGAGTTGATGGCTTGCTTGCTCGTCTATGGCTTTGGTTATCTCTGCTCC
TGGTTCCACCTATTTGACGCACTCGTCATCGTCATCAGCTTCATAGTCGACGTCGGCCTTCGCGGCGTCGCTGGC
TCTATAGGCTCTCTCGTCGTCGTTCTTCGTCTGTGGCGTCTTGCCAAGCTGTCCGAGGAAGTCGTCTTGGGGGCA
TCTGAAAGGATGGACTTGTTGGAGCGTCATCTGGACGAGATTGAAAGGGAAAATAAACAGCTGAGGGTTCAGCTC
GGAGTAGAGGCCGGGCACCGTTCTAGTCGTGGTTGA
Transcript >Ophcf2|00946
ATGCCCGACTCCGGCACCGCCTCAGCCCCTCTCCTACCGTCTCACGCCCGCCGCTCCGATGGGCTGTCGTCCTCG
GCGCCGGCTTCGGGCTCGGATCTGAGCCACCGCCTGAAGCGAATGCGTGCGGCGGCTGCGAGTGGTCTCTCATCG
CGCCGCAAGCACTTTGCCATCATGGCCGTTGTCGGCGTCGACGTCTTCGCACTGCTAGTCGAAGTCTTTATCCGG
CTCATTGCTTGCGAGACGGGACAGGGCCGTGAGGCATGGGTGGTAATTACCACTTCTGTACTCGGCACTGTCGGT
CTGGTTATCAGCTGCCTCTTCATGGTCGAGTTGATGGCTTGCTTGCTCGTCTATGGCTTTGGTTATCTCTGCTCC
TGGTTCCACCTATTTGACGCACTCGTCATCGTCATCAGCTTCATAGTCGACGTCGGCCTTCGCGGCGTCGCTGGC
TCTATAGGCTCTCTCGTCGTCGTTCTTCGTCTGTGGCGTCTTGCCAAGCTGTCCGAGGAAGTCGTCTTGGGGGCA
TCTGAAAGGATGGACTTGTTGGAGCGTCATCTGGACGAGATTGAAAGGGAAAATAAACAGCTGAGGGTTCAGCTC
GGAGTAGAGGCCGGGCACCGTTCTAGTCGTGGTTGA
Gene >Ophcf2|00946
ATGCCCGACTCCGGCACCGCCTCAGCCCCTCTCCTACCGTCTCACGCCCGCCGCTCCGATGGGCTGTCGTCCTCG
GCGCCGGCTTCGGGCTCGGATCTGAGCCACCGCCTGAAGCGAATGCGTGCGGCGGCTGCGAGTGGTCTCTCATCG
CGCCGCAAGCACTTTGCCATCATGGCCGTTGTCGGCGTCGACGTCTTCGCACTGCTAGTCGAAGTCTTTATCCGG
CTCATTGCTTGCGAGACGGGACAGGGCCGTGAGGCATGGGTGGTAATTACCACTTCTGTACTCGGCACTGTCGGT
CTGGTTATCAGCTGCCTCTTCATGGTCGAGTTGATGGCTTGCTTGCTCGTCTATGGCTTTGGGTAATGGCTTCCA
TCTCTCCGTATCATACCGCTTCGTGCTGCTGACTCGAGTCTTGACAAGTTATCTCTGCTCCTGGTTCCACCTATT
TGACGCACTCGTCATCGTCATCAGCTTCATAGTCGACGTCGGCCTTCGCGGCGTCGCTGGCTCTATAGGCTCTCT
CGTCGTCGTTCTTCGTCTGTGGCGTCTTGCCAAGCTGTCCGAGGAAGTCGTCTTGGGGGCATCTGAAAGGATGGA
CTTGTTGGAGCGTCATCTGGACGAGATTGAAAGGGAAAATAAACAGCTGAGGGTTCAGCTCGGAGTAGAGGCCGG
GCACCGTTCTAGTCGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail