Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00942
Gene name
Locationscaffold_01:3631486..3632596
Strand+
Gene length (bp)1110
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 1.8E-11 77 159

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.2148 0.1621 0.1298 0.1541 0.1142 0.0085 0.5807 0.1693 0.8042 0.0097

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 2.7E-17 80 158

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6170
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00942 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4529
Ophiocordyceps kimflemingae Ophio5|2159
Ophiocordyceps subramaniannii Hirsu2|5230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00942
MMLHTLVLHIRLFLSVILAIFFFLILHDASRRGFTWTVAHKMATQTTASTLLQRLPAAHSNLPTIFHQSWMTTEL
PVKFQRWSSTCRQAHPRWEWVIWTDDDNLRLVKRFFPSLEITYRRLPGEIYRADLSRALYMYIYGGVYADLDTEC
LRPTEQLKTSYPTFFDNRLKAKALFGRMGIDPDFVHSIPNAWMASTPGHPFFLHFLQTIDDRTRDITTNNKSWPS
AEALTGPVALREAIAKYEEEKVRRGSRLKDRVAQLVRDGPFDESDYEDEQDHRVFLLPSSVVYSYSWWADGESVR
PVCWVLSEGFDAERCKQLLQVGRAKSISITYWSHTHTPTGHSDDNLKHIQG*
Coding >Ophcf2|00942
ATGATGCTCCATACGCTCGTTCTTCACATCAGGCTGTTTCTCTCCGTCATCCTCGCCATCTTCTTCTTCCTGATT
CTCCATGACGCCTCGCGTAGGGGCTTCACCTGGACTGTCGCCCACAAAATGGCCACACAGACGACGGCATCGACC
CTCCTCCAACGTCTACCAGCAGCGCACTCCAACCTCCCGACCATCTTCCACCAGAGCTGGATGACGACGGAACTG
CCGGTCAAGTTTCAACGCTGGAGTTCCACCTGTCGTCAGGCTCACCCGCGGTGGGAATGGGTTATCTGGACCGAT
GACGATAACTTACGGCTCGTTAAGAGATTCTTCCCCTCGCTCGAGATCACCTATCGTCGTCTTCCGGGAGAGATC
TACCGCGCCGATCTCAGCAGGGCTCTCTACATGTACATCTATGGCGGCGTCTACGCTGACCTCGACACAGAATGC
CTGCGGCCGACGGAGCAACTAAAGACCTCCTATCCGACCTTTTTCGACAACCGTCTCAAGGCAAAGGCCCTGTTC
GGCCGGATGGGGATAGACCCGGACTTTGTCCACTCCATCCCCAACGCCTGGATGGCATCAACCCCGGGCCATCCG
TTCTTCCTGCACTTCCTTCAGACCATCGACGACCGGACGCGCGACATTACAACCAACAACAAGTCGTGGCCCAGT
GCTGAAGCGCTGACGGGGCCTGTTGCTCTACGCGAAGCCATCGCCAAGTATGAGGAGGAAAAGGTGCGCCGAGGC
AGTCGATTGAAGGACCGCGTCGCCCAGCTCGTCAGGGATGGACCCTTTGATGAATCCGACTACGAAGACGAACAA
GACCACCGCGTCTTCCTCCTCCCCAGCAGCGTCGTCTATTCTTATAGCTGGTGGGCTGACGGCGAGTCTGTGCGT
CCAGTCTGCTGGGTTCTGAGCGAAGGCTTCGACGCCGAGAGATGTAAACAACTGCTCCAAGTTGGCCGGGCCAAG
AGCATATCCATCACTTACTGGAGTCACACGCACACGCCGACGGGGCACAGCGATGATAACCTGAAGCACATCCAG
GGGTGA
Transcript >Ophcf2|00942
ATGATGCTCCATACGCTCGTTCTTCACATCAGGCTGTTTCTCTCCGTCATCCTCGCCATCTTCTTCTTCCTGATT
CTCCATGACGCCTCGCGTAGGGGCTTCACCTGGACTGTCGCCCACAAAATGGCCACACAGACGACGGCATCGACC
CTCCTCCAACGTCTACCAGCAGCGCACTCCAACCTCCCGACCATCTTCCACCAGAGCTGGATGACGACGGAACTG
CCGGTCAAGTTTCAACGCTGGAGTTCCACCTGTCGTCAGGCTCACCCGCGGTGGGAATGGGTTATCTGGACCGAT
GACGATAACTTACGGCTCGTTAAGAGATTCTTCCCCTCGCTCGAGATCACCTATCGTCGTCTTCCGGGAGAGATC
TACCGCGCCGATCTCAGCAGGGCTCTCTACATGTACATCTATGGCGGCGTCTACGCTGACCTCGACACAGAATGC
CTGCGGCCGACGGAGCAACTAAAGACCTCCTATCCGACCTTTTTCGACAACCGTCTCAAGGCAAAGGCCCTGTTC
GGCCGGATGGGGATAGACCCGGACTTTGTCCACTCCATCCCCAACGCCTGGATGGCATCAACCCCGGGCCATCCG
TTCTTCCTGCACTTCCTTCAGACCATCGACGACCGGACGCGCGACATTACAACCAACAACAAGTCGTGGCCCAGT
GCTGAAGCGCTGACGGGGCCTGTTGCTCTACGCGAAGCCATCGCCAAGTATGAGGAGGAAAAGGTGCGCCGAGGC
AGTCGATTGAAGGACCGCGTCGCCCAGCTCGTCAGGGATGGACCCTTTGATGAATCCGACTACGAAGACGAACAA
GACCACCGCGTCTTCCTCCTCCCCAGCAGCGTCGTCTATTCTTATAGCTGGTGGGCTGACGGCGAGTCTGTGCGT
CCAGTCTGCTGGGTTCTGAGCGAAGGCTTCGACGCCGAGAGATGTAAACAACTGCTCCAAGTTGGCCGGGCCAAG
AGCATATCCATCACTTACTGGAGTCACACGCACACGCCGACGGGGCACAGCGATGATAACCTGAAGCACATCCAG
GGGTGA
Gene >Ophcf2|00942
ATGATGCTCCATACGCTCGTTCTTCACATCAGGCTGTTTCTCTCCGTCATCCTCGCCATCTTCTTCTTCCTGATT
CTCCATGACGCCTCGCGTAGGGGCTTCACCTGGACTGTCGCCCACAAAATGGCCACACAGACGACGGCATCGACC
CTCCTCCAACGTCTACCAGCAGCGCACTCCAACCTCCCGACCATCTTCCACCAGAGCTGGATGACGACGGAACTG
CCGGTCAAGTTTCAACGCTGGAGTTCCACCTGTCGTCAGGCTCACCCGCGGTGGGAATGGGTTATCTGGACCGAT
GACGATAACTTACGGCTCGTTAAGAGATTCTTCCCCTCGCTCGAGATCACCTATCGTCGTCTTCCGGGAGAGATC
TACCGCGCCGATCTCAGCAGGGCTCTCTACATGTACATCTATGGCGGGTGCGTTTTCAGCCGTCGTCGGGCCTGG
AGACAGCTTACTGACGCCAGATACAGCGTCTACGCTGACCTCGACACAGAATGCCTGCGGCCGACGGAGCAACTA
AAGACCTCCTATCCGACCTTTTTCGACAACCGTCTCAAGGCAAAGGCCCTGTTCGGCCGGATGGGGATAGACCCG
GACTTTGTCCACTCCATCCCCAACGCCTGGATGGCATCAACCCCGGGCCATCCGTTCTTCCTGCACTTCCTTCAG
ACCATCGACGACCGGACGCGCGACATTACAACCAACAACAAGTCGTGGCCCAGTGCTGAAGCGCTGACGGGGCCT
GTTGCTCTACGCGAAGCCATCGCCAAGTATGAGGAGGAAAAGGTGCGCCGAGGCAGTCGATTGAAGGACCGCGTC
GCCCAGCTCGTCAGGGATGGACCCTTTGATGAATCCGACTACGAAGACGAACAAGACCACCGCGTCTTCCTCCTC
CCCAGCAGCGTCGTCTATTCTTATAGCTGGTGGGCTGACGGCGAGTCTGTGCGTCCAGTCTGCTGGGTTCTGAGC
GAAGGCTTCGACGCCGAGAGATGTAAACAACTGCTCCAAGTTGGCCGGGCCAAGAGCATATCCATCACTTACTGG
AGTCACACGCACACGCCGACGGGGCACAGCGATGATAACCTGAAGCACATCCAGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail