Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00941
Gene name
Locationscaffold_01:3627717..3629490
Strand-
Gene length (bp)1773
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 2.7E-09 453 574

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 46.36 26.42 66.30
Alive In ants, during behavior modification 155.83 53.44 258.22
Dead In ants, recently dead 93.33 51.81 134.85

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.016813 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00941
MRSERRLWPLRLAIRYLTVALLVSLALLNFLLWHQTQPPFGHRHPIQRLMAEAETRARLLMARRSLDLPTAAARY
RHRRRRHPPPGFDDWFRAAVEADAVVVEDFFDRIYKDVTPFWALSPSSIRRRATAWHWVVRVRNGTASAQGNVKG
RVPWLQLWTALVSEFSSKLPDVDMPVNMLDEARILVPHADMARLVAKAESETTMADPDLASSRFSGLADVDHHPP
PLYEPPWFGPGNSYWNLAAKTCGPDTPAHGVRQIRDFAPPAELPPDWRPSYSLEGFVQNWTAAMDPCLQPHLRQL
HGTFIEPLSLSSTDELIPIFGGSKLPMNSEMLIPGAMYLTDDTFYSGGEAHGPAWPDKKDGLIWRGDASGGRAKE
HSWHHFQRHRLVDMLNGTTVSRLEASGVRAPTFSLPSTGLYRRRRQLGAWIARFADAAFVHLCPPGECDFVSPYF
RPSDQVPMEAQYQHKFLPDADGNSFSARFRGFLRSTSLPIKATIYAEWHDDRLIPWLHFVPMDNTFQDLYALLDF
FAPRGLLNNRGDAAARLIAERGRDWAETVLRREDMRLYVWRLLLEWARVCDDERHNLGFVDDLRS*
Coding >Ophcf2|00941
ATGCGCTCCGAGCGCCGGCTATGGCCCCTAAGACTCGCCATCCGCTACCTCACCGTAGCGCTACTCGTCTCGTTG
GCGTTGCTCAACTTCCTGCTCTGGCACCAGACGCAGCCTCCCTTTGGCCATCGACATCCCATCCAACGGCTCATG
GCCGAGGCCGAGACCCGAGCTCGGCTTCTCATGGCTCGTCGAAGTCTGGATCTCCCTACGGCTGCGGCGCGGTAT
CGCCATCGGAGGAGAAGACATCCGCCTCCGGGATTCGACGATTGGTTTCGCGCTGCTGTTGAGGCTGACGCCGTC
GTGGTTGAGGACTTCTTCGATCGCATATACAAAGATGTCACTCCCTTCTGGGCCCTATCACCCTCGTCTATACGT
CGAAGAGCCACGGCCTGGCATTGGGTAGTCCGCGTTCGCAACGGCACAGCATCGGCTCAAGGAAACGTCAAAGGC
CGCGTCCCCTGGCTTCAGCTCTGGACAGCCCTGGTCTCAGAGTTCTCCTCCAAGCTACCAGACGTCGACATGCCC
GTCAACATGCTAGACGAAGCCCGCATCTTGGTCCCCCACGCAGACATGGCCAGACTGGTAGCCAAAGCCGAGTCC
GAGACGACCATGGCGGACCCGGACCTTGCCTCGTCACGCTTCTCAGGCCTCGCCGACGTCGACCATCATCCTCCA
CCGCTGTATGAACCCCCCTGGTTCGGCCCGGGCAACTCGTACTGGAATCTGGCCGCCAAGACGTGCGGCCCCGAC
ACACCCGCCCACGGCGTCCGTCAGATTCGAGACTTTGCTCCTCCCGCCGAGTTGCCCCCCGACTGGCGACCGTCG
TACTCGCTGGAGGGCTTCGTCCAGAACTGGACGGCCGCCATGGATCCCTGTCTACAGCCTCATCTGCGTCAGCTG
CACGGCACCTTCATCGAACCCCTGAGCCTGTCATCGACCGACGAGCTCATCCCCATCTTCGGCGGCTCCAAGTTG
CCCATGAACAGCGAGATGCTCATCCCGGGCGCCATGTACCTCACCGACGATACCTTCTACTCGGGCGGTGAGGCC
CACGGTCCAGCCTGGCCCGATAAGAAGGACGGCCTCATCTGGCGAGGTGATGCTTCGGGAGGTCGTGCCAAGGAG
CACAGCTGGCATCACTTCCAGCGCCATCGTCTCGTCGACATGCTCAACGGGACCACCGTCTCCCGCCTCGAAGCC
TCGGGAGTCCGCGCCCCGACCTTCTCCCTACCTTCTACCGGCCTGTACCGCCGTCGCCGCCAGCTGGGCGCCTGG
ATCGCCCGCTTCGCCGACGCCGCCTTCGTCCACCTCTGTCCGCCCGGCGAGTGCGACTTCGTGAGCCCCTACTTC
CGGCCCTCGGATCAGGTCCCCATGGAAGCCCAGTATCAGCACAAGTTCCTGCCCGACGCCGACGGCAACTCCTTC
AGCGCCCGTTTCCGCGGCTTCCTGCGCTCTACCTCGCTGCCCATCAAGGCCACCATCTACGCCGAGTGGCACGAC
GACCGCCTGATTCCCTGGCTGCACTTTGTGCCCATGGACAACACTTTTCAGGATCTCTACGCGCTGCTCGACTTC
TTCGCCCCTCGAGGCTTACTTAACAACAGGGGCGACGCGGCTGCCCGCCTCATCGCTGAAAGGGGTCGTGACTGG
GCCGAGACGGTTCTACGGAGGGAGGACATGCGTCTCTATGTGTGGCGCTTGCTCCTCGAATGGGCGCGCGTCTGC
GATGACGAGAGGCATAATCTGGGCTTTGTAGATGATTTGAGGAGCTGA
Transcript >Ophcf2|00941
ATGCGCTCCGAGCGCCGGCTATGGCCCCTAAGACTCGCCATCCGCTACCTCACCGTAGCGCTACTCGTCTCGTTG
GCGTTGCTCAACTTCCTGCTCTGGCACCAGACGCAGCCTCCCTTTGGCCATCGACATCCCATCCAACGGCTCATG
GCCGAGGCCGAGACCCGAGCTCGGCTTCTCATGGCTCGTCGAAGTCTGGATCTCCCTACGGCTGCGGCGCGGTAT
CGCCATCGGAGGAGAAGACATCCGCCTCCGGGATTCGACGATTGGTTTCGCGCTGCTGTTGAGGCTGACGCCGTC
GTGGTTGAGGACTTCTTCGATCGCATATACAAAGATGTCACTCCCTTCTGGGCCCTATCACCCTCGTCTATACGT
CGAAGAGCCACGGCCTGGCATTGGGTAGTCCGCGTTCGCAACGGCACAGCATCGGCTCAAGGAAACGTCAAAGGC
CGCGTCCCCTGGCTTCAGCTCTGGACAGCCCTGGTCTCAGAGTTCTCCTCCAAGCTACCAGACGTCGACATGCCC
GTCAACATGCTAGACGAAGCCCGCATCTTGGTCCCCCACGCAGACATGGCCAGACTGGTAGCCAAAGCCGAGTCC
GAGACGACCATGGCGGACCCGGACCTTGCCTCGTCACGCTTCTCAGGCCTCGCCGACGTCGACCATCATCCTCCA
CCGCTGTATGAACCCCCCTGGTTCGGCCCGGGCAACTCGTACTGGAATCTGGCCGCCAAGACGTGCGGCCCCGAC
ACACCCGCCCACGGCGTCCGTCAGATTCGAGACTTTGCTCCTCCCGCCGAGTTGCCCCCCGACTGGCGACCGTCG
TACTCGCTGGAGGGCTTCGTCCAGAACTGGACGGCCGCCATGGATCCCTGTCTACAGCCTCATCTGCGTCAGCTG
CACGGCACCTTCATCGAACCCCTGAGCCTGTCATCGACCGACGAGCTCATCCCCATCTTCGGCGGCTCCAAGTTG
CCCATGAACAGCGAGATGCTCATCCCGGGCGCCATGTACCTCACCGACGATACCTTCTACTCGGGCGGTGAGGCC
CACGGTCCAGCCTGGCCCGATAAGAAGGACGGCCTCATCTGGCGAGGTGATGCTTCGGGAGGTCGTGCCAAGGAG
CACAGCTGGCATCACTTCCAGCGCCATCGTCTCGTCGACATGCTCAACGGGACCACCGTCTCCCGCCTCGAAGCC
TCGGGAGTCCGCGCCCCGACCTTCTCCCTACCTTCTACCGGCCTGTACCGCCGTCGCCGCCAGCTGGGCGCCTGG
ATCGCCCGCTTCGCCGACGCCGCCTTCGTCCACCTCTGTCCGCCCGGCGAGTGCGACTTCGTGAGCCCCTACTTC
CGGCCCTCGGATCAGGTCCCCATGGAAGCCCAGTATCAGCACAAGTTCCTGCCCGACGCCGACGGCAACTCCTTC
AGCGCCCGTTTCCGCGGCTTCCTGCGCTCTACCTCGCTGCCCATCAAGGCCACCATCTACGCCGAGTGGCACGAC
GACCGCCTGATTCCCTGGCTGCACTTTGTGCCCATGGACAACACTTTTCAGGATCTCTACGCGCTGCTCGACTTC
TTCGCCCCTCGAGGCTTACTTAACAACAGGGGCGACGCGGCTGCCCGCCTCATCGCTGAAAGGGGTCGTGACTGG
GCCGAGACGGTTCTACGGAGGGAGGACATGCGTCTCTATGTGTGGCGCTTGCTCCTCGAATGGGCGCGCGTCTGC
GATGACGAGAGGCATAATCTGGGCTTTGTAGATGATTTGAGGAGCTGA
Gene >Ophcf2|00941
ATGCGCTCCGAGCGCCGGCTATGGCCCCTAAGACTCGCCATCCGCTACCTCACCGTAGCGCTACTCGTCTCGTTG
GCGTTGCTCAACTTCCTGCTCTGGCACCAGACGCAGCCTCCCTTTGGCCATCGACATCCCATCCAACGGCTCATG
GCCGAGGCCGAGACCCGAGCTCGGCTTCTCATGGCTCGTCGAAGTCTGGATCTCCCTACGGCTGCGGCGCGGTAT
CGCCATCGGAGGAGAAGACATCCGCCTCCGGGATTCGACGATTGGTTTCGCGCTGCTGTTGAGGCTGACGCCGTC
GTGGTTGAGGACTTCTTCGATCGCATATACAAAGATGTCACTCCCTTCTGGGCCCTATCACCCTCGTCTATACGT
CGAAGAGCCACGGCCTGGCATTGGGTAGTCCGCGTTCGCAACGGCACAGCATCGGCTCAAGGAAACGTCAAAGGC
CGCGTCCCCTGGCTTCAGCTCTGGACAGCCCTGGTCTCAGAGTTCTCCTCCAAGCTACCAGACGTCGACATGCCC
GTCAACATGCTAGACGAAGCCCGCATCTTGGTCCCCCACGCAGACATGGCCAGACTGGTAGCCAAAGCCGAGTCC
GAGACGACCATGGCGGACCCGGACCTTGCCTCGTCACGCTTCTCAGGCCTCGCCGACGTCGACCATCATCCTCCA
CCGCTGTATGAACCCCCCTGGTTCGGCCCGGGCAACTCGTACTGGAATCTGGCCGCCAAGACGTGCGGCCCCGAC
ACACCCGCCCACGGCGTCCGTCAGATTCGAGACTTTGCTCCTCCCGCCGAGTTGCCCCCCGACTGGCGACCGTCG
TACTCGCTGGAGGGCTTCGTCCAGAACTGGACGGCCGCCATGGATCCCTGTCTACAGCCTCATCTGCGTCAGCTG
CACGGCACCTTCATCGAACCCCTGAGCCTGTCATCGACCGACGAGCTCATCCCCATCTTCGGCGGCTCCAAGTTG
CCCATGAACAGCGAGATGCTCATCCCGGGCGCCATGTACCTCACCGACGATACCTTCTACTCGGGCGGTGAGGCC
CACGGTCCAGCCTGGCCCGATAAGAAGGACGGCCTCATCTGGCGAGGTGATGCTTCGGGAGGTCGTGCCAAGGAG
CACAGCTGGCATCACTTCCAGCGCCATCGTCTCGTCGACATGCTCAACGGGACCACCGTCTCCCGCCTCGAAGCC
TCGGGAGTCCGCGCCCCGACCTTCTCCCTACCTTCTACCGGCCTGTACCGCCGTCGCCGCCAGCTGGGCGCCTGG
ATCGCCCGCTTCGCCGACGCCGCCTTCGTCCACCTCTGTCCGCCCGGCGAGTGCGACTTCGTGAGCCCCTACTTC
CGGCCCTCGGATCAGGTCCCCATGGAAGCCCAGTATCAGCACAAGTTCCTGCCCGACGCCGACGGCAACTCCTTC
AGCGCCCGTTTCCGCGGCTTCCTGCGCTCTACCTCGCTGCCCATCAAGGCCACCATCTACGCCGAGTGGCACGAC
GACCGCCTGATTCCCTGGCTGCACTTTGTGCCCATGGACAACACTTTTCAGGATCTCTACGCGCTGCTCGACTTC
TTCGCCCCTCGAGGCTTACTTAACAACAGGGGCGACGCGGCTGCCCGCCTCATCGCTGAAAGGGGTCGTGACTGG
GCCGAGACGGTTCTACGGAGGGAGGACATGCGTCTCTATGTGTGGCGCTTGCTCCTCGAATGGGCGCGCGTCTGC
GATGACGAGAGGCATAATCTGGGCTTTGTAGATGATTTGAGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail