Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00940
Gene name
Locationscaffold_01:3625205..3627322
Strand+
Gene length (bp)2117
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.2E-47 275 527

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5482 0.4543 0.0211 0.0859 0.0733 0.009 0.0626 0.3191 0.5336 0.2553

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1743
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|331
Ophiocordyceps australis map64 (Brazil) OphauB2|7745
Ophiocordyceps camponoti-floridani Ophcf2|00940 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4527
Ophiocordyceps kimflemingae Ophio5|7950
Ophiocordyceps subramaniannii Hirsu2|1614

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00940
MWSSSGSGKKPAQSEMIQVDRSDSASPFWRPPARDNANRRGAPTSSSRDSNLVVGAAYSHADMLKLESLNVSGPS
RPKTPPSTAKIRVHEATPPPRSSVNSNSPPFKNYINFLSNTNDDWKTDEDEMLGYEDDDGDDFGLPSLSNMKRRS
RKMAAQGKSDGGSLSPAIDGSFGRPIRRLSNSADIAVERPMPSYPMPKKSEGKILRPQYKEILRDPANALHLISY
PSVPNEASAREADAINSRITRINKFKKLLQASAISLPDLRALAWSGVPEEVRAMTWQLLLSYLPTNSERRVATLQ
RKRKEYLDGVRQAFDRAGAGSGAAGKARGLDEAIWHQISIDIPRTNPHIELYGYEATQRSLERILYLWAVRHPAS
GYVQGINDLVTPFWQVFLGLYIGDHNIETGMDPGQLPKSVLDAVEADSFWCLTKLLDGIQDHYIVAQPGIQRQVG
ALRDLTARIDAGLSRHLESEGVEFIQFSFRWMNCLLMREISVQNTIRMWDTYLAEEQGFSEFHLYVCAALLVKWS
DRLVKMDFQEIMMFLQSLPTKAWTEKDIELLLSEAFIWQSLYKGSAAHLKGQSRRPTPTNLQL*
Coding >Ophcf2|00940
ATGTGGTCATCTTCCGGCTCTGGCAAGAAGCCGGCCCAGTCGGAGATGATCCAGGTCGATCGATCCGACTCTGCC
TCGCCCTTCTGGAGGCCACCAGCCCGCGATAATGCCAACAGGCGAGGCGCCCCAACCTCTTCGTCGCGCGACTCC
AACCTGGTGGTGGGCGCCGCCTACTCACACGCCGATATGCTCAAGCTTGAATCTTTAAACGTATCCGGTCCGTCA
CGGCCCAAGACACCACCGTCGACGGCCAAGATCCGCGTCCATGAAGCGACTCCGCCTCCGCGCAGCTCAGTCAAC
AGCAACTCCCCACCTTTCAAGAACTACATCAACTTTCTGTCCAACACCAATGACGACTGGAAGACGGATGAAGAC
GAGATGCTCGGCTACGAGGACGACGATGGCGACGACTTTGGCCTACCTAGCCTCTCCAACATGAAGCGGAGATCA
AGAAAGATGGCAGCCCAGGGGAAATCCGACGGCGGCTCCCTCTCTCCCGCCATCGACGGTTCCTTCGGCCGGCCC
ATCAGACGCCTCTCCAACAGCGCCGACATTGCCGTCGAGCGTCCGATGCCTTCGTATCCCATGCCTAAGAAGAGC
GAGGGAAAGATTCTTCGGCCGCAGTACAAGGAGATTCTCCGGGATCCGGCCAACGCGTTGCACCTCATCAGCTAC
CCGTCCGTCCCGAACGAGGCTTCGGCGCGAGAAGCGGACGCCATCAACTCGAGGATCACGCGCATCAACAAGTTC
AAGAAACTGTTGCAGGCATCAGCCATATCCCTTCCAGATTTGAGGGCCCTCGCATGGTCAGGGGTTCCGGAGGAG
GTGCGCGCCATGACCTGGCAGCTCCTCCTCAGCTATCTCCCCACCAACAGCGAGAGAAGAGTGGCGACGCTTCAG
CGGAAGCGCAAGGAATACCTAGACGGGGTTCGGCAGGCCTTTGACCGGGCGGGGGCCGGCTCCGGTGCGGCGGGC
AAGGCGCGCGGCCTGGACGAGGCCATCTGGCACCAGATCAGCATCGATATCCCGCGCACGAACCCGCACATCGAG
CTGTACGGCTACGAGGCGACGCAGCGGTCGCTGGAGCGCATCCTCTACCTGTGGGCCGTCAGACACCCGGCCAGC
GGCTACGTTCAGGGCATCAACGATCTGGTGACGCCCTTCTGGCAGGTCTTTCTCGGCCTGTACATCGGCGACCAC
AACATCGAGACGGGCATGGACCCGGGCCAGCTTCCCAAGTCGGTCCTCGACGCCGTTGAAGCCGACTCGTTCTGG
TGCCTGACCAAGCTGCTCGATGGCATCCAGGACCATTACATCGTGGCCCAGCCCGGTATCCAGCGCCAGGTGGGC
GCCCTGCGAGACTTGACGGCCCGCATCGATGCCGGCTTGTCGAGGCACCTGGAGAGCGAGGGCGTCGAGTTCATC
CAGTTCAGCTTCCGCTGGATGAACTGCCTGCTGATGCGCGAGATAAGCGTACAGAACACGATCCGCATGTGGGAC
ACGTACCTGGCGGAAGAGCAGGGCTTCTCCGAGTTCCACCTGTACGTCTGCGCCGCCCTACTCGTAAAGTGGTCC
GACAGGCTTGTCAAGATGGACTTTCAGGAGATTATGATGTTTCTGCAGAGCCTCCCGACAAAGGCCTGGACGGAA
AAGGACATCGAGCTGCTCCTCAGCGAGGCCTTCATCTGGCAGAGCCTGTACAAGGGATCGGCCGCCCACCTCAAG
GGCCAGTCGCGGCGGCCGACGCCGACCAATTTGCAGCTTTGA
Transcript >Ophcf2|00940
ATGTGGTCATCTTCCGGCTCTGGCAAGAAGCCGGCCCAGTCGGAGATGATCCAGGTCGATCGATCCGACTCTGCC
TCGCCCTTCTGGAGGCCACCAGCCCGCGATAATGCCAACAGGCGAGGCGCCCCAACCTCTTCGTCGCGCGACTCC
AACCTGGTGGTGGGCGCCGCCTACTCACACGCCGATATGCTCAAGCTTGAATCTTTAAACGTATCCGGTCCGTCA
CGGCCCAAGACACCACCGTCGACGGCCAAGATCCGCGTCCATGAAGCGACTCCGCCTCCGCGCAGCTCAGTCAAC
AGCAACTCCCCACCTTTCAAGAACTACATCAACTTTCTGTCCAACACCAATGACGACTGGAAGACGGATGAAGAC
GAGATGCTCGGCTACGAGGACGACGATGGCGACGACTTTGGCCTACCTAGCCTCTCCAACATGAAGCGGAGATCA
AGAAAGATGGCAGCCCAGGGGAAATCCGACGGCGGCTCCCTCTCTCCCGCCATCGACGGTTCCTTCGGCCGGCCC
ATCAGACGCCTCTCCAACAGCGCCGACATTGCCGTCGAGCGTCCGATGCCTTCGTATCCCATGCCTAAGAAGAGC
GAGGGAAAGATTCTTCGGCCGCAGTACAAGGAGATTCTCCGGGATCCGGCCAACGCGTTGCACCTCATCAGCTAC
CCGTCCGTCCCGAACGAGGCTTCGGCGCGAGAAGCGGACGCCATCAACTCGAGGATCACGCGCATCAACAAGTTC
AAGAAACTGTTGCAGGCATCAGCCATATCCCTTCCAGATTTGAGGGCCCTCGCATGGTCAGGGGTTCCGGAGGAG
GTGCGCGCCATGACCTGGCAGCTCCTCCTCAGCTATCTCCCCACCAACAGCGAGAGAAGAGTGGCGACGCTTCAG
CGGAAGCGCAAGGAATACCTAGACGGGGTTCGGCAGGCCTTTGACCGGGCGGGGGCCGGCTCCGGTGCGGCGGGC
AAGGCGCGCGGCCTGGACGAGGCCATCTGGCACCAGATCAGCATCGATATCCCGCGCACGAACCCGCACATCGAG
CTGTACGGCTACGAGGCGACGCAGCGGTCGCTGGAGCGCATCCTCTACCTGTGGGCCGTCAGACACCCGGCCAGC
GGCTACGTTCAGGGCATCAACGATCTGGTGACGCCCTTCTGGCAGGTCTTTCTCGGCCTGTACATCGGCGACCAC
AACATCGAGACGGGCATGGACCCGGGCCAGCTTCCCAAGTCGGTCCTCGACGCCGTTGAAGCCGACTCGTTCTGG
TGCCTGACCAAGCTGCTCGATGGCATCCAGGACCATTACATCGTGGCCCAGCCCGGTATCCAGCGCCAGGTGGGC
GCCCTGCGAGACTTGACGGCCCGCATCGATGCCGGCTTGTCGAGGCACCTGGAGAGCGAGGGCGTCGAGTTCATC
CAGTTCAGCTTCCGCTGGATGAACTGCCTGCTGATGCGCGAGATAAGCGTACAGAACACGATCCGCATGTGGGAC
ACGTACCTGGCGGAAGAGCAGGGCTTCTCCGAGTTCCACCTGTACGTCTGCGCCGCCCTACTCGTAAAGTGGTCC
GACAGGCTTGTCAAGATGGACTTTCAGGAGATTATGATGTTTCTGCAGAGCCTCCCGACAAAGGCCTGGACGGAA
AAGGACATCGAGCTGCTCCTCAGCGAGGCCTTCATCTGGCAGAGCCTGTACAAGGGATCGGCCGCCCACCTCAAG
GGCCAGTCGCGGCGGCCGACGCCGACCAATTTGCAGCTTTGA
Gene >Ophcf2|00940
ATGTGGTCATCTTCCGGCTCTGGCAAGAAGCCGGCCCAGTCGGTAGGTCACTGTCACGAACGCCTGGTTGGCTGC
TTGCTCACGCCTCGAGCTGCGACAGGAGATGATCCAGGTCGGTATGTCGAACGCCTCGTCTGCTCTCCCTCGTCG
CCCTGGCTAACTGCGCCTCTAGATCGATCCGAGTACGTTACGAATTCCTTTACGGAGTCCGCTGTTGCTAATCGT
GTAGCTCTGCCTCGCCCTTCTGGAGGCCACCAGCCCGCGATAATGCCAACAGGCGAGGCGCCCCAACCTCTTCGT
CGCGCGACTCCAACCTGGTGGTGGGCGCCGCCTACTCACACGCCGATATGCTCAAGCTTGAATCTTTGTTCGTCT
ACAGCCTTACTCTCCCCTCTTCCCCGTACCGTTCACCGTCGGATGGCTAACCGCGTGTCGTCCATCAGAAACGTA
TCCGGTCCGTCACGGCCCAAGACACCACCGTCGACGGCCAAGATCCGCGTCCATGAAGCGACTCCGCCTCCGCGC
AGCTCAGTCAACAGCAACTCCCCACCTTTCAAGAACTACATCAACTTTCTGTCCAACACCAATGACGACTGGAAG
ACGGATGAAGACGAGATGCTCGGCTACGAGGACGACGATGGCGACGACTTTGGCCTACCTAGCCTCTCCAACATG
AAGCGGAGATCAAGAAAGATGGCAGCCCAGGGGAAATCCGACGGCGGCTCCCTCTCTCCCGCCATCGACGGTTCC
TTCGGCCGGCCCATCAGACGCCTCTCCAACAGCGCCGACATTGCCGTCGAGCGTCCGATGCCTTCGTATCCCATG
CCTAAGAAGAGCGAGGGAAAGATTCTTCGGCCGCAGTACAAGGAGATTCTCCGGGGTTCGTACCGACCGTCTCGC
CTCGGTCGGACCACGGCTGGCTGACATCTTCGCCACAGATCCGGCCAACGCGTTGCACCTCATCAGCTACCCGTC
CGTCCCGAACGAGGCTTCGGCGCGAGAAGCGGACGCCATCAACTCGAGGATCACGCGCATCAACAAGTTCAAGAA
ACTGTTGCAGGCATCAGCCATATCCCTTCCAGATTTGAGGGCCCTCGCATGGTCAGGGGTTCCGGAGGAGGTGCG
CGCCATGACCTGGCAGCTCCTCCTCAGCTATCTCCCCACCAACAGCGAGAGAAGAGTGGCGACGCTTCAGCGGAA
GCGCAAGGAATACCTAGACGGGGTTCGGCAGGCCTTTGACCGGGCGGGGGCCGGCTCCGGTGCGGCGGGCAAGGC
GCGCGGCCTGGACGAGGCCATCTGGCACCAGATCAGCATCGATATCCCGCGCACGAACCCGCACATCGAGCTGTA
CGGCTACGAGGCGACGCAGCGGTCGCTGGAGCGCATCCTCTACCTGTGGGCCGTCAGACACCCGGCCAGCGGCTA
CGTTCAGGGCATCAACGATCTGGTGACGCCCTTCTGGCAGGTCTTTCTCGGCCTGTACATCGGCGACCACAACAT
CGAGACGGGCATGGACCCGGGCCAGCTTCCCAAGTCGGTCCTCGACGCCGTTGAAGCCGACTCGTTCTGGTGCCT
GACCAAGCTGCTCGATGGCATCCAGGACCATTACATCGTGGCCCAGCCCGGTATCCAGCGCCAGGTGGGCGCCCT
GCGAGACTTGACGGCCCGCATCGATGCCGGCTTGTCGAGGCACCTGGAGAGCGAGGGCGTCGAGTTCATCCAGTT
CAGCTTCCGCTGGATGAACTGCCTGCTGATGCGCGAGATAAGCGTACAGAACACGATCCGCATGTGGGACACGTA
CCTGGTGAGCCCCCCCCCCCAATACATTCCTCTAACACTCGAGACTGACATGCCTCGAGGCGGAAGAGCAGGGCT
TCTCCGAGTTCCACCTGTACGTCTGCGCCGCCCTACTCGTAAAGTGGTCCGACAGGCTTGTCAAGATGGACTTTC
AGGAGATTATGATGTTTCTGCAGAGCCTCCCGACAAAGGCCTGGACGGAAAAGGACATCGAGCTGCTCCTCAGCG
AGGCCTTCATCTGGCAGAGCCTGTACAAGGGATCGGCCGCCCACCTCAAGGGCCAGTCGCGGCGGCCGACGCCGA
CCAATTTGCAGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail