Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00937
Gene name
Locationscaffold_01:3612584..3614040
Strand+
Gene length (bp)1456
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 3.9E-29 148 276

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2068 0.8684 0.0699 0.0325 0.105 0.0075 0.0611 0.0176 0.0282 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 230.40 120.55 340.26
Alive In ants, during behavior modification 208.32 108.31 308.33
Dead In ants, recently dead 244.74 124.73 364.75

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.681435 no
Alive Dead 0.416946 no
Dead Fungus 0.818535 no

Orthologs

Orthofinder run ID4
Orthogroup1593
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5371
Ophiocordyceps australis map64 (Brazil) OphauB2|3952
Ophiocordyceps camponoti-floridani Ophcf2|00937 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4524
Ophiocordyceps kimflemingae Ophio5|4821
Ophiocordyceps subramaniannii Hirsu2|1221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00937
MSSTSDSHQAGKRKRAAAAKASADVALQTSSRDASGEEGDTTAPESSRHHRINGAGPNPKRQRANPDRAVDVADH
ALDPGEPSDTTEASVDIAERVGRKARKPVVKDCHDDDADKMEAMPPPPIGKLTHPAGGFKTNSPPVGRPVRVYAD
GVFDLFHLGHMRQLEQAKKAFPDTTLVVGVTGDKETHMRKGLTVLSAQERAETVRHCKWVDEVIEDCPWIVTPEF
LEANRLDYVAHDDLPYGADEGDDIYQPIKAAGKFLVTQRTEGVSTTGIITRIVRDYEKYLTRQFKRGTPRQELNV
SWIKKNELDLKRHVQDLRDNIIANWTTTGQELSRELKQFWPASRPQSPARFNSSGSDVARSPISSTSGPGNSKEF
VTGYALGLVGGVRSWMTKNRRTVSDSQHASEDESDEAEERKKSPTMPSPSA*
Coding >Ophcf2|00937
ATGTCGTCCACCTCCGACTCTCACCAGGCCGGCAAACGCAAGAGAGCGGCCGCCGCCAAGGCCTCGGCTGACGTC
GCCCTCCAGACCTCCTCGCGCGATGCCTCGGGCGAAGAAGGCGACACCACCGCCCCCGAGTCCAGCCGCCATCAC
CGCATCAACGGTGCCGGTCCGAACCCTAAGCGGCAGCGGGCCAACCCGGACCGTGCTGTCGATGTCGCCGACCAC
GCTCTCGACCCGGGCGAGCCCAGCGACACCACCGAGGCCAGCGTCGACATCGCCGAGCGCGTCGGTCGAAAGGCT
CGCAAGCCAGTCGTCAAGGACTGCCATGACGATGACGCCGACAAGATGGAAGCCATGCCGCCTCCGCCCATCGGA
AAGCTGACCCATCCTGCCGGCGGCTTCAAGACAAACTCGCCACCCGTCGGTCGCCCGGTCCGCGTTTACGCTGAC
GGCGTCTTTGACCTGTTTCATCTCGGGCACATGCGCCAGCTCGAGCAGGCCAAGAAGGCCTTTCCCGACACCACG
CTCGTCGTCGGCGTCACAGGCGATAAGGAGACGCATATGCGCAAGGGCCTGACTGTTCTTTCTGCCCAGGAACGC
GCCGAGACGGTTCGACACTGCAAGTGGGTTGACGAGGTCATTGAAGACTGCCCATGGATCGTTACGCCCGAGTTC
CTCGAGGCCAATCGGCTCGACTACGTCGCACACGATGATCTGCCCTACGGCGCCGACGAAGGCGACGACATCTAT
CAGCCCATCAAGGCCGCCGGCAAGTTTCTCGTCACCCAGCGAACCGAGGGTGTCAGCACCACTGGCATCATCACC
AGAATCGTCCGCGACTACGAAAAGTATCTCACCCGGCAGTTCAAGCGCGGCACTCCGCGACAGGAACTCAACGTC
AGCTGGATCAAGAAGAACGAGCTGGACCTGAAGCGCCATGTGCAGGACCTGCGAGATAACATCATCGCAAACTGG
ACGACGACGGGCCAGGAGCTGAGTCGCGAGCTGAAGCAATTCTGGCCCGCCAGTCGACCGCAGAGCCCGGCTCGT
TTCAACTCGTCCGGAAGCGACGTGGCCCGGTCGCCCATCAGCTCGACCTCGGGCCCGGGCAACTCGAAGGAGTTT
GTCACGGGATACGCCCTCGGTCTTGTAGGCGGCGTGCGGTCCTGGATGACCAAGAACAGAAGGACCGTATCTGAC
AGCCAACATGCAAGCGAGGACGAGTCGGACGAGGCCGAGGAACGCAAGAAATCGCCAACTATGCCTTCACCCTCG
GCTTGA
Transcript >Ophcf2|00937
ATGTCGTCCACCTCCGACTCTCACCAGGCCGGCAAACGCAAGAGAGCGGCCGCCGCCAAGGCCTCGGCTGACGTC
GCCCTCCAGACCTCCTCGCGCGATGCCTCGGGCGAAGAAGGCGACACCACCGCCCCCGAGTCCAGCCGCCATCAC
CGCATCAACGGTGCCGGTCCGAACCCTAAGCGGCAGCGGGCCAACCCGGACCGTGCTGTCGATGTCGCCGACCAC
GCTCTCGACCCGGGCGAGCCCAGCGACACCACCGAGGCCAGCGTCGACATCGCCGAGCGCGTCGGTCGAAAGGCT
CGCAAGCCAGTCGTCAAGGACTGCCATGACGATGACGCCGACAAGATGGAAGCCATGCCGCCTCCGCCCATCGGA
AAGCTGACCCATCCTGCCGGCGGCTTCAAGACAAACTCGCCACCCGTCGGTCGCCCGGTCCGCGTTTACGCTGAC
GGCGTCTTTGACCTGTTTCATCTCGGGCACATGCGCCAGCTCGAGCAGGCCAAGAAGGCCTTTCCCGACACCACG
CTCGTCGTCGGCGTCACAGGCGATAAGGAGACGCATATGCGCAAGGGCCTGACTGTTCTTTCTGCCCAGGAACGC
GCCGAGACGGTTCGACACTGCAAGTGGGTTGACGAGGTCATTGAAGACTGCCCATGGATCGTTACGCCCGAGTTC
CTCGAGGCCAATCGGCTCGACTACGTCGCACACGATGATCTGCCCTACGGCGCCGACGAAGGCGACGACATCTAT
CAGCCCATCAAGGCCGCCGGCAAGTTTCTCGTCACCCAGCGAACCGAGGGTGTCAGCACCACTGGCATCATCACC
AGAATCGTCCGCGACTACGAAAAGTATCTCACCCGGCAGTTCAAGCGCGGCACTCCGCGACAGGAACTCAACGTC
AGCTGGATCAAGAAGAACGAGCTGGACCTGAAGCGCCATGTGCAGGACCTGCGAGATAACATCATCGCAAACTGG
ACGACGACGGGCCAGGAGCTGAGTCGCGAGCTGAAGCAATTCTGGCCCGCCAGTCGACCGCAGAGCCCGGCTCGT
TTCAACTCGTCCGGAAGCGACGTGGCCCGGTCGCCCATCAGCTCGACCTCGGGCCCGGGCAACTCGAAGGAGTTT
GTCACGGGATACGCCCTCGGTCTTGTAGGCGGCGTGCGGTCCTGGATGACCAAGAACAGAAGGACCGTATCTGAC
AGCCAACATGCAAGCGAGGACGAGTCGGACGAGGCCGAGGAACGCAAGAAATCGCCAACTATGCCTTCACCCTCG
GCTTGA
Gene >Ophcf2|00937
ATGTCGTCCACCTCCGACTCTCACCAGGCCGGCAAACGCAAGAGAGCGGCCGCCGCCAAGGCCTCGGCTGACGTC
GCCCTCCAGACCTCCTCGCGCGATGCCTCGGGCGAAGAAGGCGACACCACCGCCCCCGAGTCCAGCCGCCATCAC
CGCATCAACGGTGCCGGTCCGAACCCTAAGCGGCAGCGGGCCAACCCGGACCGTGCTGTCGATGTCGCCGACCAC
GCTCTCGACCCGGGCGAGCCCAGCGACACCACCGAGGCCAGCGTCGACATCGCCGAGCGCGTCGGTCGAAAGGCT
CGCAAGCCAGTCGTCAAGGACTGCCATGACGATGACGCCGACAAGATGGAAGCCATGCCGCCTCCGCCCATCGGA
AAGCTGACCCATCCTGCCGGCGGCTTCAAGACAAACTCGCCACCCGTCGGTCGCCCGGTCCGCGTTTACGCTGAC
GGCGTCTTTGACCTGTTTCATCTCGGGCATGTCCACACCTTGTTCCGTCTCGCGTTGCTGCCTCTGACCGTCAAC
CGTCCTTCAGGCACATGCGCCAGCTCGAGCAGGCCAAGAAGGCCTTTCCCGACACCACGCTCGTCGTCGGCGTCA
CAGGCGATAAGGAGACGCATATGCGCAAGGGCCTGACTGTTCTTTCTGCCCAGGAACGCGCCGAGACGGTTCGAC
ACTGCAAGTGGGTTGACGAGGTCATTGAAGACTGCCCATGGATCGTTACGCCCGAGTTCCTCGAGGCCAATCGGC
TCGACTACGTCGCACACGATGATCTGCCCTACGGCGCCGACGAAGGCGACGACATCTATCAGCCCATCAAGGCCG
CCGGCAAGTTTCTCGTCACCCAGCGAACCGAGGGTGTCAGCACCACTGGCATCATCACCAGGTCCGTAACGCCCT
TATTTCGCCTGATCCCCCTTCGTTAGCCTGACGTGTGCCGCACTCCAGAATCGTCCGCGACTACGAAAAGTATCT
CACCCGGCAGTTCAAGCGCGGCACTCCGCGACAGGAACTCAACGTCAGCTGGATCAAGAAGAACGAGCTGGACCT
GAAGCGCCATGTGCAGGACCTGCGAGATAACATCATCGCAAACTGGACGACGACGGGCCAGGAGCTGAGTCGCGA
GCTGAAGCAATTCTGGCCCGCCAGTCGACCGCAGAGCCCGGCTCGTTTCAACTCGTCCGGAAGCGACGTGGCCCG
GTCGCCCATCAGCTCGACCTCGGGCCCGGGCAACTCGAAGGAGTTTGTCACGGGATACGCCCTCGGTCTTGTAGG
CGGCGTGCGGTCCTGGGTGAGAAATCAGACTCCGTGAGCGGCTAAATTGCAAGCTGACAGAAGTTTGCAGATGAC
CAAGAACAGAAGGACCGTATCTGACAGCCAACATGCAAGCGAGGACGAGTCGGACGAGGCCGAGGAACGCAAGAA
ATCGCCAACTATGCCTTCACCCTCGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail