Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00932
Gene name
Locationscaffold_01:3598279..3598819
Strand+
Gene length (bp)540
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02891 zf-MIZ MIZ/SP-RING zinc finger 3.1E-10 43 96

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3586 0.9082 0.0793 0.0737 0.0203 0.0009 0.0576 0.0793 0.0618 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5303
Ophiocordyceps australis map64 (Brazil) OphauB2|3841
Ophiocordyceps camponoti-floridani Ophcf2|00931
Ophiocordyceps camponoti-floridani Ophcf2|00932 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4955
Ophiocordyceps kimflemingae Ophio5|5282
Ophiocordyceps subramaniannii Hirsu2|2359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00932
MVEDNPRTSIEETKQKICQRLKPAGSDDIIAEGDHICVAVTDPFSSSLFAIPVRGADCKHWECFDLNIWLRTRPG
KRSSDTGEPTIPDCWKCPICDLDARPVRLRIDEFFTDVRAKLIMNGEESIKKICIQFDGSWRPLPEPDEAEDEKQ
SPAASGQKRPVLSQATGPEPAQVIFIEDD*
Coding >Ophcf2|00932
ATGGTCGAGGATAACCCCAGGACCAGCATCGAAGAGACCAAGCAGAAAATATGCCAGCGACTGAAGCCGGCTGGC
TCGGACGACATCATTGCCGAGGGCGACCACATTTGTGTGGCAGTGACGGATCCTTTTAGCTCTTCCCTCTTTGCG
ATTCCCGTTCGAGGAGCCGACTGCAAGCACTGGGAGTGCTTCGATTTGAACATCTGGCTGCGGACTCGCCCCGGA
AAGCGGTCCAGCGACACAGGAGAACCGACTATACCGGACTGTTGGAAATGCCCCATCTGCGATCTGGACGCGAGG
CCTGTCCGCCTTCGCATTGACGAGTTCTTCACCGACGTTCGGGCCAAGCTCATCATGAACGGGGAGGAAAGTATC
AAAAAGATATGCATCCAGTTTGATGGTTCCTGGCGTCCGCTGCCGGAACCGGACGAGGCCGAAGATGAGAAACAG
TCGCCCGCCGCATCTGGCCAAAAGCGACCCGTGCTCTCACAGGCTACAGGTCCGGAGCCCGCGCAAGTGATATTC
ATTGAAGACGACTAG
Transcript >Ophcf2|00932
ATGGTCGAGGATAACCCCAGGACCAGCATCGAAGAGACCAAGCAGAAAATATGCCAGCGACTGAAGCCGGCTGGC
TCGGACGACATCATTGCCGAGGGCGACCACATTTGTGTGGCAGTGACGGATCCTTTTAGCTCTTCCCTCTTTGCG
ATTCCCGTTCGAGGAGCCGACTGCAAGCACTGGGAGTGCTTCGATTTGAACATCTGGCTGCGGACTCGCCCCGGA
AAGCGGTCCAGCGACACAGGAGAACCGACTATACCGGACTGTTGGAAATGCCCCATCTGCGATCTGGACGCGAGG
CCTGTCCGCCTTCGCATTGACGAGTTCTTCACCGACGTTCGGGCCAAGCTCATCATGAACGGGGAGGAAAGTATC
AAAAAGATATGCATCCAGTTTGATGGTTCCTGGCGTCCGCTGCCGGAACCGGACGAGGCCGAAGATGAGAAACAG
TCGCCCGCCGCATCTGGCCAAAAGCGACCCGTGCTCTCACAGGCTACAGGTCCGGAGCCCGCGCAAGTGATATTC
ATTGAAGACGACTAG
Gene >Ophcf2|00932
ATGGTCGAGGATAACCCCAGGACCAGCATCGAAGAGACCAAGCAGAAAATATGCCAGCGACTGAAGCCGGCTGGC
TCGGACGACATCATTGCCGAGGGCGACCACATTTGTGTGGCAGTGACGGATCCTTTTAGCTCTTCCCTCTTTGCG
ATTCCCGTTCGAGGAGCCGACTGCAAGCACTGGGAGTGCTTCGATTTGAACATCTGGCTGCGGACTCGCCCCGGA
AAGCGGTCCAGCGACACAGGAGAACCGACTATACCGGACTGTTGGAAATGCCCCATCTGCGATCTGGACGCGAGG
CCTGTCCGCCTTCGCATTGACGAGTTCTTCACCGACGTTCGGGCCAAGCTCATCATGAACGGGGAGGAAAGTATC
AAAAAGATATGCATCCAGTTTGATGGTTCCTGGCGTCCGCTGCCGGAACCGGACGAGGCCGAAGATGAGAAACAG
TCGCCCGCCGCATCTGGCCAAAAGCGACCCGTGCTCTCACAGGCTACAGGTCCGGAGCCCGCGCAAGTGATATTC
ATTGAAGACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail