Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00931
Gene name
Locationscaffold_01:3595931..3597782
Strand+
Gene length (bp)1851
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.47 0.874 0.1026 0.0233 0.169 0.0121 0.0518 0.0806 0.0399 0.0752

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5303
Ophiocordyceps australis map64 (Brazil) OphauB2|3841
Ophiocordyceps camponoti-floridani Ophcf2|00931 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00932
Ophiocordyceps camponoti-rufipedis Ophun1|4955
Ophiocordyceps kimflemingae Ophio5|5282
Ophiocordyceps subramaniannii Hirsu2|2359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00931
MAGSPPTAQVPSPPSLDPLSSTEADPCPVPATSRHLAPTQQESTAEYTELCLLPVSTRSNAPPAAEICPTPQPNQ
PPPTPRSLLPSTFATPQNHVRQSDVPDRQQKRHCSDASRQLLTAQSAFGGYTVDFDQLLAVVENHVRQLGNAIRG
DVIAYRLLASACSKSDFFFLVLHQAYCLWSLSSRVACWLLDAEPHVVDAAFHQLQWSWRRNSDLSPYHLRWFASF
PLLTTRNSDAMRLPKLMASSLMPVINNFLVLMGQNWSVVLGQVVHRGYPLMAWEMNHLLQCPSPVLRSILFICSR
QPFGVFEESPSTNALSQLFDLDFCNEASGHVDSPDVVRMRMIIRDRFISLMQQARACSSNHISVANQAQVLAQQH
LAIHNPSSATQQILPALPMTSQAVPMSSPASSTPRNAGNQYLPVLRSNANMGVAQGPAQPHLVPFGFSGSPSVAG
GGQTGGVFTSSTTPNTTPPQPAPYFPRMQQAQMVPTTQRPMPAVQTRVPQTTATAILASSARGPGSYPQPQHTSS
QASQPALTWPSAAVQPPSIESFRWGIMSFLERSGPEPNMACTCHLCAART*
Coding >Ophcf2|00931
ATGGCTGGCTCTCCGCCGACGGCCCAGGTTCCGAGCCCGCCGTCGTTGGACCCTCTTTCGTCCACCGAAGCCGAT
CCGTGTCCTGTGCCGGCTACATCGCGCCATCTCGCTCCGACGCAGCAAGAATCGACAGCCGAATACACCGAGCTT
TGTCTGCTGCCCGTATCGACCCGGTCAAACGCACCGCCCGCTGCCGAAATCTGCCCGACGCCTCAACCCAACCAG
CCACCTCCCACGCCCCGGTCACTATTGCCTAGCACGTTCGCCACACCTCAGAATCACGTTCGACAGAGCGACGTA
CCAGACAGGCAGCAGAAGCGACATTGTTCCGACGCTTCGCGACAGCTTTTGACTGCCCAGTCCGCCTTTGGGGGC
TATACCGTCGACTTTGACCAGTTGCTAGCCGTCGTCGAGAATCATGTGCGACAATTGGGAAACGCCATCCGCGGT
GATGTCATCGCCTATAGGCTGCTGGCATCCGCTTGCTCCAAGTCGGATTTCTTCTTCCTTGTCCTGCATCAAGCA
TACTGTCTCTGGTCGTTAAGCAGTCGAGTGGCCTGTTGGTTGCTCGATGCCGAGCCGCACGTCGTGGACGCGGCA
TTCCACCAACTGCAATGGTCATGGAGGCGAAACTCGGATTTATCGCCCTACCACCTTCGCTGGTTCGCCTCGTTT
CCTCTCCTGACAACGAGAAACTCAGATGCCATGCGCCTCCCCAAACTCATGGCCTCCAGCCTCATGCCCGTCATC
AACAATTTCCTCGTCTTGATGGGGCAGAATTGGAGTGTCGTACTGGGACAAGTCGTCCACAGAGGCTACCCGCTA
ATGGCATGGGAGATGAATCACCTCTTGCAATGCCCATCGCCTGTGCTGCGATCAATCCTCTTCATCTGTAGTCGC
CAACCCTTTGGTGTTTTCGAGGAAAGTCCCTCAACGAATGCCTTGTCCCAGCTATTTGACCTGGATTTCTGCAAC
GAAGCTTCGGGACATGTCGACTCGCCCGATGTGGTCAGGATGAGGATGATCATCAGGGATAGGTTTATTTCCCTG
ATGCAACAAGCCAGAGCTTGTTCGTCCAACCATATATCTGTAGCCAACCAAGCTCAAGTCCTGGCACAGCAGCAT
CTGGCCATACATAATCCATCGTCAGCAACGCAGCAGATTTTACCGGCACTGCCGATGACTTCTCAAGCTGTCCCC
ATGTCGTCACCCGCATCTTCGACGCCTCGAAACGCTGGCAACCAATACTTGCCCGTATTGAGGAGCAATGCCAAC
ATGGGTGTTGCTCAAGGGCCGGCTCAGCCTCACCTGGTGCCATTCGGTTTCTCCGGCTCGCCGTCTGTCGCTGGC
GGCGGGCAGACGGGCGGTGTCTTCACATCGTCCACGACGCCCAACACGACTCCGCCTCAACCTGCGCCGTATTTC
CCGCGAATGCAACAGGCACAGATGGTGCCAACGACGCAGCGTCCGATGCCGGCGGTTCAGACCCGCGTCCCGCAA
ACGACGGCAACGGCGATTCTTGCTTCTTCTGCCCGAGGCCCGGGCTCTTATCCACAGCCGCAGCACACAAGCTCT
CAGGCTTCGCAGCCTGCGTTGACGTGGCCCAGTGCCGCCGTTCAGCCTCCCAGCATCGAGTCGTTCCGCTGGGGG
ATCATGAGCTTCCTCGAGAGGAGTGGGCCCGAGCCCAACATGGCCTGCACTTGTCATCTCTGCGCAGCCCGAACC
TGA
Transcript >Ophcf2|00931
ATGGCTGGCTCTCCGCCGACGGCCCAGGTTCCGAGCCCGCCGTCGTTGGACCCTCTTTCGTCCACCGAAGCCGAT
CCGTGTCCTGTGCCGGCTACATCGCGCCATCTCGCTCCGACGCAGCAAGAATCGACAGCCGAATACACCGAGCTT
TGTCTGCTGCCCGTATCGACCCGGTCAAACGCACCGCCCGCTGCCGAAATCTGCCCGACGCCTCAACCCAACCAG
CCACCTCCCACGCCCCGGTCACTATTGCCTAGCACGTTCGCCACACCTCAGAATCACGTTCGACAGAGCGACGTA
CCAGACAGGCAGCAGAAGCGACATTGTTCCGACGCTTCGCGACAGCTTTTGACTGCCCAGTCCGCCTTTGGGGGC
TATACCGTCGACTTTGACCAGTTGCTAGCCGTCGTCGAGAATCATGTGCGACAATTGGGAAACGCCATCCGCGGT
GATGTCATCGCCTATAGGCTGCTGGCATCCGCTTGCTCCAAGTCGGATTTCTTCTTCCTTGTCCTGCATCAAGCA
TACTGTCTCTGGTCGTTAAGCAGTCGAGTGGCCTGTTGGTTGCTCGATGCCGAGCCGCACGTCGTGGACGCGGCA
TTCCACCAACTGCAATGGTCATGGAGGCGAAACTCGGATTTATCGCCCTACCACCTTCGCTGGTTCGCCTCGTTT
CCTCTCCTGACAACGAGAAACTCAGATGCCATGCGCCTCCCCAAACTCATGGCCTCCAGCCTCATGCCCGTCATC
AACAATTTCCTCGTCTTGATGGGGCAGAATTGGAGTGTCGTACTGGGACAAGTCGTCCACAGAGGCTACCCGCTA
ATGGCATGGGAGATGAATCACCTCTTGCAATGCCCATCGCCTGTGCTGCGATCAATCCTCTTCATCTGTAGTCGC
CAACCCTTTGGTGTTTTCGAGGAAAGTCCCTCAACGAATGCCTTGTCCCAGCTATTTGACCTGGATTTCTGCAAC
GAAGCTTCGGGACATGTCGACTCGCCCGATGTGGTCAGGATGAGGATGATCATCAGGGATAGGTTTATTTCCCTG
ATGCAACAAGCCAGAGCTTGTTCGTCCAACCATATATCTGTAGCCAACCAAGCTCAAGTCCTGGCACAGCAGCAT
CTGGCCATACATAATCCATCGTCAGCAACGCAGCAGATTTTACCGGCACTGCCGATGACTTCTCAAGCTGTCCCC
ATGTCGTCACCCGCATCTTCGACGCCTCGAAACGCTGGCAACCAATACTTGCCCGTATTGAGGAGCAATGCCAAC
ATGGGTGTTGCTCAAGGGCCGGCTCAGCCTCACCTGGTGCCATTCGGTTTCTCCGGCTCGCCGTCTGTCGCTGGC
GGCGGGCAGACGGGCGGTGTCTTCACATCGTCCACGACGCCCAACACGACTCCGCCTCAACCTGCGCCGTATTTC
CCGCGAATGCAACAGGCACAGATGGTGCCAACGACGCAGCGTCCGATGCCGGCGGTTCAGACCCGCGTCCCGCAA
ACGACGGCAACGGCGATTCTTGCTTCTTCTGCCCGAGGCCCGGGCTCTTATCCACAGCCGCAGCACACAAGCTCT
CAGGCTTCGCAGCCTGCGTTGACGTGGCCCAGTGCCGCCGTTCAGCCTCCCAGCATCGAGTCGTTCCGCTGGGGG
ATCATGAGCTTCCTCGAGAGGAGTGGGCCCGAGCCCAACATGGCCTGCACTTGTCATCTCTGCGCAGCCCGAACC
TGA
Gene >Ophcf2|00931
ATGGCTGGCTCTCCGCCGACGGCCCAGGTTCCGAGCCCGCCGTCGTTGGACCCTCTTTCGTCCACCGAAGCCGAT
CCGTGTCCTGTGCCGGCTACATCGCGCCATCTCGCTCCGACGCAGCAAGAATCGACAGCCGAATACACCGAGCTT
TGTCTGCTGCCCGTATCGACCCGGTCAAACGCACCGCCCGCTGCCGAAATCTGCCCGACGCCTCAACCCAACCAG
CCACCTCCCACGCCCCGGTCACTATTGCCTAGCACGTTCGCCACACCTCAGAATCACGTTCGACAGAGCGACGTA
CCAGACAGGCAGCAGAAGCGACATTGTTCCGACGCTTCGCGACAGCTTTTGACTGCCCAGTCCGCCTTTGGGGGC
TATACCGTCGACTTTGACCAGTTGCTAGCCGTCGTCGAGAATCATGTGCGACAATTGGGAAACGCCATCCGCGGT
GATGTCATCGCCTATAGGCTGCTGGCATCCGCTTGCTCCAAGTCGGATTTCTTCTTCCTTGTCCTGCATCAAGCA
TACTGTCTCTGGTCGTTAAGCAGTCGAGTGGCCTGTTGGTTGCTCGATGCCGAGCCGCACGTCGTGGACGCGGCA
TTCCACCAACTGCAATGGTCATGGAGGCGAAACTCGGATTTATCGCCCTACCACCTTCGCTGGTTCGCCTCGTTT
CCTCTCCTGACAACGAGAAACTCAGATGCCATGCGCCTCCCCAAACTCATGGCCTCCAGCCTCATGCCCGTCATC
AACAATTTCCTCGTCTTGATGGGGCAGAATTGGAGTGTCGTACTGGGACAAGTCGTCCACAGAGGCTACCCGCTA
ATGGCATGGGAGATGAATCACCTCTTGCAATGCCCATCGCCTGTGCTGCGATCAATCCTCTTCATCTGTAGTCGC
CAACCCTTTGGTGTTTTCGAGGAAAGTCCCTCAACGAATGCCTTGTCCCAGCTATTTGACCTGGATTTCTGCAAC
GAAGCTTCGGGACATGTCGACTCGCCCGATGTGGTCAGGATGAGGATGATCATCAGGGATAGGTTTATTTCCCTG
ATGCAACAAGCCAGAGGTAACGTACCTGCACCCGTCCACGAGATATTCTTCTTACTGATTGAAAACTGGAAGCTT
GTTCGTCCAACCATATATCTGTAGCCAACCAAGCTCAAGTCCTGGCACAGCAGCATCTGGCCATACATAATCCAT
CGTCAGCAACGCAGCAGATTTTACCGGCACTGCCGATGACTTCTCAAGCTGTCCCCATGTCGTCACCCGCATCTT
CGACGCCTCGAAACGCTGGCAACCAATACTTGCCCGTATTGAGGAGCAATGCCAACATGGGTGTTGCTCAAGGGC
CGGCTCAGCCTCACCTGGTGCCATTCGGTTTCTCCGGCTCGCCGTCTGTCGCTGGCGGCGGGCAGACGGGCGGTG
TCTTCACATCGTCCACGACGCCCAACACGACTCCGCCTCAACCTGCGCCGTATTTCCCGCGAATGCAACAGGCAC
AGATGGTGCCAACGACGCAGCGTCCGATGCCGGCGGTTCAGACCCGCGTCCCGCAAACGACGGCAACGGCGATTC
TTGCTTCTTCTGCCCGAGGCCCGGGCTCTTATCCACAGCCGCAGCACACAAGCTCTCAGGCTTCGCAGCCTGCGT
TGACGTGGCCCAGTGCCGCCGTTCAGCCTCGTCCGGGCCCTCGATCCGTCATTGTGCCGACACAGACTACGCCGC
GGACACGGGGCGTAACGACCAGCCAGCATCGAGTCGTTCCGCTGGGGGATCATGAGCTTCCTCGAGAGGAGTGGG
CCCGAGCCCAACATGGCCTGCACTTGTCATCTCTGCGCAGCCCGAACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail