Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00926
Gene name
Locationscaffold_01:3511584..3515061
Strand+
Gene length (bp)3477
Transcript length (bp)3477
Coding sequence length (bp)3477
Protein length (aa) 1159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00250 Forkhead Forkhead domain 6.0E-14 719 785

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0080090 regulation of primary metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0005488 binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051252 regulation of RNA metabolic process No
GO:0003677 DNA binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0065007 biological regulation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2759 0.935 0.1299 0.0131 0.0182 0.0048 0.0253 0.0109 0.0116 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Forkhead

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4944
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|99
Ophiocordyceps australis map64 (Brazil) OphauB2|5603
Ophiocordyceps camponoti-floridani Ophcf2|00926 (this protein)
Ophiocordyceps kimflemingae Ophio5|4568
Ophiocordyceps subramaniannii Hirsu2|1857

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00926
MASSSDGAVCGMEPEPLRAVDDDDDMGPEAFSDCRPASAAAVDLRQNISASSAPAADLPDRPESAMAVSTAAPEP
PAAAVLPSTPSPKRSLESSALLAVRDSSPGIKSLVTDASSAETGEATKFDDKKKQQQEQQGGLQDQDQPHQPCQE
KQLQDSQHPSQMANGQSAMPDPYTPSTPFTASSMANLDHQTFMMMALASMSASAAPAMSPPPTVTPAQVTLPNPA
DDSHGSLSHGQGLRNGNPNKDLESFSRLEFADSVFQMTTYAVIIGRDQRALQQARRDEKRAEEYKRRVEENASKG
LPPPSPIQHDRSKFSKSYVSEEGGMLGPESDSDDNDGGRPSKRRKMSSAPSSHVDNDDGQDDIISDRQYVSHTPG
AAAVDLTYLRPSPYHVPFIGIHSPGPNIASKTKAISREHLKIAYSQEDGVFEAIPLHKNGFFCEDVHYKSEKVVL
RCGDRLQIKDVGFRFIINGVERGCTGAEEFIEEDEAAKTRQDHGGKEMSFDFEQAHGNGQIQDTSDELSDIGVTP
PELSDFGIDRDAPEPQPEPEPEPEHEMEEAGHGATNGAVPKAEPTLPPPPPKKRGPGRPPKNGIMSKREQRLLKK
QQQLQQQQELQLQQQQQQQQQQQQQLRQQQRDAQGAGDKNPSAAEPPVKRKVGRPRKHPLPEDGGDRPEKRKYKS
RKPKNEDVGSDAERRAREKKDKKARPKSPPLDLKIEDYSEEQLQKPSKNYGILIDETLTAAGPDGLTLKQIYKRI
CQRYPWFFFHTETKGWESSVRHNLIGNEAFKKDDTTGLWSRVPGVELDAGKKRKVSSPDRVLAAQGCGQYPFAYG
VAQQMPASAVAGHASGQSAPSAGYHHVPGLPGQQPARPMLTQGSSAPATGAETGPGPGPGPVSQQTVARPPGPPQ
VHGYGPPPIPARAPVVGAPSGAYSSPYTSRPPPLAPTPVKTEDGAPAAANPGQKAPSGPSAAETAPDPGPVRPVM
DPRLVGAVVELKNGLINNLKRAHFPQAEAVVMSALNRCIGLKQDGGGSEHMETVCFKAINQVIDGYMAKNKSPIP
GGSSTASDVRSPSSSSSSMLFDPKVLKSLIGFKVASIEPLRARLGDSRAETLALSAMDRVLGLADASFFATASST
AQSNGNFETVEQHLMKTVRQLLIGMKQELPEAK*
Coding >Ophcf2|00926
ATGGCTTCGTCCAGCGACGGTGCGGTCTGCGGCATGGAGCCTGAGCCGCTGCGCGCCGTGGACGATGACGACGAC
ATGGGCCCTGAAGCTTTCTCAGACTGCAGACCTGCATCCGCTGCGGCCGTCGACTTGAGGCAAAACATCTCTGCT
TCGTCTGCTCCTGCCGCCGATTTGCCGGACAGGCCTGAATCCGCCATGGCCGTATCCACCGCCGCCCCTGAGCCT
CCTGCTGCTGCCGTCCTTCCATCGACGCCGTCGCCCAAGAGGTCTCTCGAGTCCTCAGCTCTTCTCGCTGTTCGA
GACTCGAGTCCAGGAATCAAGTCTCTCGTCACGGACGCTTCGAGCGCAGAGACTGGCGAGGCGACAAAATTCGAC
GACAAGAAGAAGCAGCAGCAGGAACAACAAGGGGGGCTACAAGACCAAGATCAGCCGCATCAGCCGTGTCAAGAA
AAGCAGCTCCAAGACTCACAGCATCCTTCTCAGATGGCCAACGGACAGTCCGCTATGCCCGACCCCTATACCCCC
TCGACACCATTCACGGCCTCCTCGATGGCCAACCTCGACCATCAAACCTTTATGATGATGGCTCTGGCCTCCATG
TCGGCTTCCGCGGCTCCAGCAATGTCTCCTCCGCCCACTGTCACTCCTGCTCAAGTCACCCTTCCCAACCCGGCC
GATGACAGCCATGGTAGTCTGTCCCACGGCCAAGGCCTGCGGAACGGGAACCCCAACAAGGATCTCGAGTCCTTC
TCGCGCCTAGAGTTTGCCGATAGCGTCTTTCAGATGACCACATACGCCGTCATCATCGGCCGCGACCAGCGCGCT
CTCCAACAGGCTCGTCGCGACGAGAAGCGCGCCGAGGAGTACAAGCGACGCGTCGAAGAAAACGCCAGCAAAGGT
CTCCCTCCCCCGTCTCCCATTCAACACGACCGCAGTAAGTTTAGCAAATCCTACGTCAGCGAAGAAGGCGGCATG
CTGGGCCCCGAGTCCGACAGCGATGACAACGACGGCGGCCGTCCGTCGAAGCGCCGGAAGATGAGCTCTGCTCCC
TCGTCGCACGTAGACAACGACGACGGCCAGGACGACATCATCTCTGACCGTCAATACGTCTCTCACACCCCCGGC
GCCGCCGCGGTTGACCTCACCTATCTGCGCCCCTCCCCCTATCACGTTCCTTTCATCGGTATCCATTCGCCTGGC
CCCAACATCGCTAGCAAGACAAAGGCCATTTCTCGAGAACACCTCAAGATCGCATACAGCCAAGAAGATGGCGTC
TTTGAGGCCATTCCCCTGCACAAAAATGGCTTCTTCTGCGAAGACGTCCATTACAAGTCGGAAAAGGTCGTCCTC
CGCTGCGGCGATCGGCTGCAGATCAAAGACGTCGGCTTCCGCTTCATCATTAACGGCGTCGAGAGGGGCTGCACC
GGTGCTGAGGAGTTTATTGAGGAGGACGAGGCAGCCAAAACGCGGCAAGATCACGGAGGCAAGGAGATGAGCTTC
GACTTCGAACAGGCGCACGGAAATGGCCAGATCCAGGACACCAGTGACGAGTTGTCCGACATCGGAGTCACCCCC
CCGGAGCTGTCTGACTTCGGCATCGATCGTGACGCACCCGAGCCCCAGCCTGAGCCTGAGCCCGAGCCCGAGCAC
GAGATGGAGGAGGCCGGACATGGAGCAACAAACGGAGCTGTCCCGAAGGCCGAACCCACATTGCCACCACCACCA
CCCAAAAAGAGAGGGCCCGGGCGACCGCCTAAAAACGGAATCATGTCGAAGCGAGAGCAGCGGCTACTTAAGAAG
CAGCAGCAGCTCCAGCAGCAGCAAGAGCTCCAATTACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAA
CTACGGCAACAACAACGAGACGCACAAGGCGCAGGCGACAAGAACCCCTCCGCAGCTGAGCCCCCAGTCAAGAGA
AAGGTTGGTCGGCCAAGAAAACACCCTTTGCCGGAGGATGGGGGCGACAGGCCGGAGAAGCGCAAATATAAGTCA
AGGAAGCCCAAGAACGAGGATGTCGGCTCCGACGCCGAGAGACGAGCTCGGGAAAAGAAGGATAAAAAGGCCCGG
CCCAAGTCGCCGCCCCTGGACCTCAAGATCGAGGACTACTCCGAGGAGCAGCTGCAGAAACCCAGCAAGAATTAC
GGCATTCTCATCGACGAGACGCTGACGGCCGCTGGGCCCGATGGTCTGACCCTGAAGCAGATATACAAGAGAATA
TGCCAACGCTACCCCTGGTTCTTTTTCCACACCGAGACCAAAGGCTGGGAGAGCAGCGTCCGCCACAACCTCATC
GGCAACGAGGCCTTCAAGAAGGACGACACGACGGGACTGTGGTCTCGTGTTCCGGGCGTCGAGCTCGATGCCGGC
AAGAAGCGCAAGGTGTCGTCTCCAGACCGAGTCCTGGCCGCCCAGGGCTGCGGGCAGTACCCCTTTGCCTATGGT
GTCGCTCAGCAGATGCCGGCGTCCGCCGTTGCAGGTCATGCTTCAGGCCAGTCGGCGCCATCGGCCGGTTACCAT
CATGTGCCGGGACTTCCGGGGCAGCAGCCGGCTCGGCCAATGCTAACGCAGGGTAGCTCGGCTCCCGCGACCGGT
GCCGAAACCGGACCCGGACCCGGACCCGGACCCGTTAGTCAGCAGACCGTCGCCCGGCCACCCGGTCCTCCGCAG
GTGCACGGCTACGGGCCACCACCGATCCCCGCCCGGGCACCGGTCGTGGGAGCCCCGTCCGGCGCGTACAGCTCC
CCCTACACGTCGCGGCCTCCGCCCCTGGCCCCGACGCCGGTCAAGACGGAAGACGGCGCGCCAGCGGCAGCCAAT
CCCGGCCAGAAAGCACCGTCCGGGCCAAGCGCAGCGGAGACGGCGCCAGACCCGGGGCCAGTCAGGCCCGTCATG
GACCCGCGGCTGGTCGGAGCCGTCGTCGAACTCAAGAACGGACTCATCAACAATCTCAAGCGAGCGCACTTCCCC
CAAGCCGAAGCCGTCGTCATGTCAGCCCTTAACCGCTGCATCGGGCTAAAGCAAGACGGGGGAGGGTCGGAACAT
ATGGAGACGGTCTGCTTCAAGGCCATTAACCAAGTCATCGACGGCTACATGGCCAAGAACAAGAGCCCCATACCA
GGGGGCTCCTCGACGGCGTCAGACGTCCGCTCACCATCGTCATCGTCATCTTCGATGCTCTTTGATCCAAAAGTG
CTCAAGTCGCTCATCGGGTTCAAGGTGGCGTCGATAGAGCCGCTTCGGGCACGGCTGGGCGATTCCCGGGCCGAG
ACGCTCGCGCTATCGGCAATGGATCGCGTGCTGGGCCTAGCGGATGCCAGCTTCTTCGCCACGGCATCGTCGACG
GCGCAGTCTAATGGGAACTTTGAGACGGTGGAGCAGCATCTGATGAAGACGGTTCGGCAGTTATTGATTGGTATG
AAGCAGGAGCTTCCGGAAGCCAAGTAG
Transcript >Ophcf2|00926
ATGGCTTCGTCCAGCGACGGTGCGGTCTGCGGCATGGAGCCTGAGCCGCTGCGCGCCGTGGACGATGACGACGAC
ATGGGCCCTGAAGCTTTCTCAGACTGCAGACCTGCATCCGCTGCGGCCGTCGACTTGAGGCAAAACATCTCTGCT
TCGTCTGCTCCTGCCGCCGATTTGCCGGACAGGCCTGAATCCGCCATGGCCGTATCCACCGCCGCCCCTGAGCCT
CCTGCTGCTGCCGTCCTTCCATCGACGCCGTCGCCCAAGAGGTCTCTCGAGTCCTCAGCTCTTCTCGCTGTTCGA
GACTCGAGTCCAGGAATCAAGTCTCTCGTCACGGACGCTTCGAGCGCAGAGACTGGCGAGGCGACAAAATTCGAC
GACAAGAAGAAGCAGCAGCAGGAACAACAAGGGGGGCTACAAGACCAAGATCAGCCGCATCAGCCGTGTCAAGAA
AAGCAGCTCCAAGACTCACAGCATCCTTCTCAGATGGCCAACGGACAGTCCGCTATGCCCGACCCCTATACCCCC
TCGACACCATTCACGGCCTCCTCGATGGCCAACCTCGACCATCAAACCTTTATGATGATGGCTCTGGCCTCCATG
TCGGCTTCCGCGGCTCCAGCAATGTCTCCTCCGCCCACTGTCACTCCTGCTCAAGTCACCCTTCCCAACCCGGCC
GATGACAGCCATGGTAGTCTGTCCCACGGCCAAGGCCTGCGGAACGGGAACCCCAACAAGGATCTCGAGTCCTTC
TCGCGCCTAGAGTTTGCCGATAGCGTCTTTCAGATGACCACATACGCCGTCATCATCGGCCGCGACCAGCGCGCT
CTCCAACAGGCTCGTCGCGACGAGAAGCGCGCCGAGGAGTACAAGCGACGCGTCGAAGAAAACGCCAGCAAAGGT
CTCCCTCCCCCGTCTCCCATTCAACACGACCGCAGTAAGTTTAGCAAATCCTACGTCAGCGAAGAAGGCGGCATG
CTGGGCCCCGAGTCCGACAGCGATGACAACGACGGCGGCCGTCCGTCGAAGCGCCGGAAGATGAGCTCTGCTCCC
TCGTCGCACGTAGACAACGACGACGGCCAGGACGACATCATCTCTGACCGTCAATACGTCTCTCACACCCCCGGC
GCCGCCGCGGTTGACCTCACCTATCTGCGCCCCTCCCCCTATCACGTTCCTTTCATCGGTATCCATTCGCCTGGC
CCCAACATCGCTAGCAAGACAAAGGCCATTTCTCGAGAACACCTCAAGATCGCATACAGCCAAGAAGATGGCGTC
TTTGAGGCCATTCCCCTGCACAAAAATGGCTTCTTCTGCGAAGACGTCCATTACAAGTCGGAAAAGGTCGTCCTC
CGCTGCGGCGATCGGCTGCAGATCAAAGACGTCGGCTTCCGCTTCATCATTAACGGCGTCGAGAGGGGCTGCACC
GGTGCTGAGGAGTTTATTGAGGAGGACGAGGCAGCCAAAACGCGGCAAGATCACGGAGGCAAGGAGATGAGCTTC
GACTTCGAACAGGCGCACGGAAATGGCCAGATCCAGGACACCAGTGACGAGTTGTCCGACATCGGAGTCACCCCC
CCGGAGCTGTCTGACTTCGGCATCGATCGTGACGCACCCGAGCCCCAGCCTGAGCCTGAGCCCGAGCCCGAGCAC
GAGATGGAGGAGGCCGGACATGGAGCAACAAACGGAGCTGTCCCGAAGGCCGAACCCACATTGCCACCACCACCA
CCCAAAAAGAGAGGGCCCGGGCGACCGCCTAAAAACGGAATCATGTCGAAGCGAGAGCAGCGGCTACTTAAGAAG
CAGCAGCAGCTCCAGCAGCAGCAAGAGCTCCAATTACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAA
CTACGGCAACAACAACGAGACGCACAAGGCGCAGGCGACAAGAACCCCTCCGCAGCTGAGCCCCCAGTCAAGAGA
AAGGTTGGTCGGCCAAGAAAACACCCTTTGCCGGAGGATGGGGGCGACAGGCCGGAGAAGCGCAAATATAAGTCA
AGGAAGCCCAAGAACGAGGATGTCGGCTCCGACGCCGAGAGACGAGCTCGGGAAAAGAAGGATAAAAAGGCCCGG
CCCAAGTCGCCGCCCCTGGACCTCAAGATCGAGGACTACTCCGAGGAGCAGCTGCAGAAACCCAGCAAGAATTAC
GGCATTCTCATCGACGAGACGCTGACGGCCGCTGGGCCCGATGGTCTGACCCTGAAGCAGATATACAAGAGAATA
TGCCAACGCTACCCCTGGTTCTTTTTCCACACCGAGACCAAAGGCTGGGAGAGCAGCGTCCGCCACAACCTCATC
GGCAACGAGGCCTTCAAGAAGGACGACACGACGGGACTGTGGTCTCGTGTTCCGGGCGTCGAGCTCGATGCCGGC
AAGAAGCGCAAGGTGTCGTCTCCAGACCGAGTCCTGGCCGCCCAGGGCTGCGGGCAGTACCCCTTTGCCTATGGT
GTCGCTCAGCAGATGCCGGCGTCCGCCGTTGCAGGTCATGCTTCAGGCCAGTCGGCGCCATCGGCCGGTTACCAT
CATGTGCCGGGACTTCCGGGGCAGCAGCCGGCTCGGCCAATGCTAACGCAGGGTAGCTCGGCTCCCGCGACCGGT
GCCGAAACCGGACCCGGACCCGGACCCGGACCCGTTAGTCAGCAGACCGTCGCCCGGCCACCCGGTCCTCCGCAG
GTGCACGGCTACGGGCCACCACCGATCCCCGCCCGGGCACCGGTCGTGGGAGCCCCGTCCGGCGCGTACAGCTCC
CCCTACACGTCGCGGCCTCCGCCCCTGGCCCCGACGCCGGTCAAGACGGAAGACGGCGCGCCAGCGGCAGCCAAT
CCCGGCCAGAAAGCACCGTCCGGGCCAAGCGCAGCGGAGACGGCGCCAGACCCGGGGCCAGTCAGGCCCGTCATG
GACCCGCGGCTGGTCGGAGCCGTCGTCGAACTCAAGAACGGACTCATCAACAATCTCAAGCGAGCGCACTTCCCC
CAAGCCGAAGCCGTCGTCATGTCAGCCCTTAACCGCTGCATCGGGCTAAAGCAAGACGGGGGAGGGTCGGAACAT
ATGGAGACGGTCTGCTTCAAGGCCATTAACCAAGTCATCGACGGCTACATGGCCAAGAACAAGAGCCCCATACCA
GGGGGCTCCTCGACGGCGTCAGACGTCCGCTCACCATCGTCATCGTCATCTTCGATGCTCTTTGATCCAAAAGTG
CTCAAGTCGCTCATCGGGTTCAAGGTGGCGTCGATAGAGCCGCTTCGGGCACGGCTGGGCGATTCCCGGGCCGAG
ACGCTCGCGCTATCGGCAATGGATCGCGTGCTGGGCCTAGCGGATGCCAGCTTCTTCGCCACGGCATCGTCGACG
GCGCAGTCTAATGGGAACTTTGAGACGGTGGAGCAGCATCTGATGAAGACGGTTCGGCAGTTATTGATTGGTATG
AAGCAGGAGCTTCCGGAAGCCAAGTAG
Gene >Ophcf2|00926
ATGGCTTCGTCCAGCGACGGTGCGGTCTGCGGCATGGAGCCTGAGCCGCTGCGCGCCGTGGACGATGACGACGAC
ATGGGCCCTGAAGCTTTCTCAGACTGCAGACCTGCATCCGCTGCGGCCGTCGACTTGAGGCAAAACATCTCTGCT
TCGTCTGCTCCTGCCGCCGATTTGCCGGACAGGCCTGAATCCGCCATGGCCGTATCCACCGCCGCCCCTGAGCCT
CCTGCTGCTGCCGTCCTTCCATCGACGCCGTCGCCCAAGAGGTCTCTCGAGTCCTCAGCTCTTCTCGCTGTTCGA
GACTCGAGTCCAGGAATCAAGTCTCTCGTCACGGACGCTTCGAGCGCAGAGACTGGCGAGGCGACAAAATTCGAC
GACAAGAAGAAGCAGCAGCAGGAACAACAAGGGGGGCTACAAGACCAAGATCAGCCGCATCAGCCGTGTCAAGAA
AAGCAGCTCCAAGACTCACAGCATCCTTCTCAGATGGCCAACGGACAGTCCGCTATGCCCGACCCCTATACCCCC
TCGACACCATTCACGGCCTCCTCGATGGCCAACCTCGACCATCAAACCTTTATGATGATGGCTCTGGCCTCCATG
TCGGCTTCCGCGGCTCCAGCAATGTCTCCTCCGCCCACTGTCACTCCTGCTCAAGTCACCCTTCCCAACCCGGCC
GATGACAGCCATGGTAGTCTGTCCCACGGCCAAGGCCTGCGGAACGGGAACCCCAACAAGGATCTCGAGTCCTTC
TCGCGCCTAGAGTTTGCCGATAGCGTCTTTCAGATGACCACATACGCCGTCATCATCGGCCGCGACCAGCGCGCT
CTCCAACAGGCTCGTCGCGACGAGAAGCGCGCCGAGGAGTACAAGCGACGCGTCGAAGAAAACGCCAGCAAAGGT
CTCCCTCCCCCGTCTCCCATTCAACACGACCGCAGTAAGTTTAGCAAATCCTACGTCAGCGAAGAAGGCGGCATG
CTGGGCCCCGAGTCCGACAGCGATGACAACGACGGCGGCCGTCCGTCGAAGCGCCGGAAGATGAGCTCTGCTCCC
TCGTCGCACGTAGACAACGACGACGGCCAGGACGACATCATCTCTGACCGTCAATACGTCTCTCACACCCCCGGC
GCCGCCGCGGTTGACCTCACCTATCTGCGCCCCTCCCCCTATCACGTTCCTTTCATCGGTATCCATTCGCCTGGC
CCCAACATCGCTAGCAAGACAAAGGCCATTTCTCGAGAACACCTCAAGATCGCATACAGCCAAGAAGATGGCGTC
TTTGAGGCCATTCCCCTGCACAAAAATGGCTTCTTCTGCGAAGACGTCCATTACAAGTCGGAAAAGGTCGTCCTC
CGCTGCGGCGATCGGCTGCAGATCAAAGACGTCGGCTTCCGCTTCATCATTAACGGCGTCGAGAGGGGCTGCACC
GGTGCTGAGGAGTTTATTGAGGAGGACGAGGCAGCCAAAACGCGGCAAGATCACGGAGGCAAGGAGATGAGCTTC
GACTTCGAACAGGCGCACGGAAATGGCCAGATCCAGGACACCAGTGACGAGTTGTCCGACATCGGAGTCACCCCC
CCGGAGCTGTCTGACTTCGGCATCGATCGTGACGCACCCGAGCCCCAGCCTGAGCCTGAGCCCGAGCCCGAGCAC
GAGATGGAGGAGGCCGGACATGGAGCAACAAACGGAGCTGTCCCGAAGGCCGAACCCACATTGCCACCACCACCA
CCCAAAAAGAGAGGGCCCGGGCGACCGCCTAAAAACGGAATCATGTCGAAGCGAGAGCAGCGGCTACTTAAGAAG
CAGCAGCAGCTCCAGCAGCAGCAAGAGCTCCAATTACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAA
CTACGGCAACAACAACGAGACGCACAAGGCGCAGGCGACAAGAACCCCTCCGCAGCTGAGCCCCCAGTCAAGAGA
AAGGTTGGTCGGCCAAGAAAACACCCTTTGCCGGAGGATGGGGGCGACAGGCCGGAGAAGCGCAAATATAAGTCA
AGGAAGCCCAAGAACGAGGATGTCGGCTCCGACGCCGAGAGACGAGCTCGGGAAAAGAAGGATAAAAAGGCCCGG
CCCAAGTCGCCGCCCCTGGACCTCAAGATCGAGGACTACTCCGAGGAGCAGCTGCAGAAACCCAGCAAGAATTAC
GGCATTCTCATCGACGAGACGCTGACGGCCGCTGGGCCCGATGGTCTGACCCTGAAGCAGATATACAAGAGAATA
TGCCAACGCTACCCCTGGTTCTTTTTCCACACCGAGACCAAAGGCTGGGAGAGCAGCGTCCGCCACAACCTCATC
GGCAACGAGGCCTTCAAGAAGGACGACACGACGGGACTGTGGTCTCGTGTTCCGGGCGTCGAGCTCGATGCCGGC
AAGAAGCGCAAGGTGTCGTCTCCAGACCGAGTCCTGGCCGCCCAGGGCTGCGGGCAGTACCCCTTTGCCTATGGT
GTCGCTCAGCAGATGCCGGCGTCCGCCGTTGCAGGTCATGCTTCAGGCCAGTCGGCGCCATCGGCCGGTTACCAT
CATGTGCCGGGACTTCCGGGGCAGCAGCCGGCTCGGCCAATGCTAACGCAGGGTAGCTCGGCTCCCGCGACCGGT
GCCGAAACCGGACCCGGACCCGGACCCGGACCCGTTAGTCAGCAGACCGTCGCCCGGCCACCCGGTCCTCCGCAG
GTGCACGGCTACGGGCCACCACCGATCCCCGCCCGGGCACCGGTCGTGGGAGCCCCGTCCGGCGCGTACAGCTCC
CCCTACACGTCGCGGCCTCCGCCCCTGGCCCCGACGCCGGTCAAGACGGAAGACGGCGCGCCAGCGGCAGCCAAT
CCCGGCCAGAAAGCACCGTCCGGGCCAAGCGCAGCGGAGACGGCGCCAGACCCGGGGCCAGTCAGGCCCGTCATG
GACCCGCGGCTGGTCGGAGCCGTCGTCGAACTCAAGAACGGACTCATCAACAATCTCAAGCGAGCGCACTTCCCC
CAAGCCGAAGCCGTCGTCATGTCAGCCCTTAACCGCTGCATCGGGCTAAAGCAAGACGGGGGAGGGTCGGAACAT
ATGGAGACGGTCTGCTTCAAGGCCATTAACCAAGTCATCGACGGCTACATGGCCAAGAACAAGAGCCCCATACCA
GGGGGCTCCTCGACGGCGTCAGACGTCCGCTCACCATCGTCATCGTCATCTTCGATGCTCTTTGATCCAAAAGTG
CTCAAGTCGCTCATCGGGTTCAAGGTGGCGTCGATAGAGCCGCTTCGGGCACGGCTGGGCGATTCCCGGGCCGAG
ACGCTCGCGCTATCGGCAATGGATCGCGTGCTGGGCCTAGCGGATGCCAGCTTCTTCGCCACGGCATCGTCGACG
GCGCAGTCTAATGGGAACTTTGAGACGGTGGAGCAGCATCTGATGAAGACGGTTCGGCAGTTATTGATTGGTATG
AAGCAGGAGCTTCCGGAAGCCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail