Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00925
Gene name
Locationscaffold_01:3509453..3510866
Strand+
Gene length (bp)1413
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16983 MFS_MOT1 Molybdate transporter of MFS superfamily 2.2E-25 26 142
PF16983 MFS_MOT1 Molybdate transporter of MFS superfamily 1.7E-35 232 350

GO

GO Term Description Terminal node
GO:0015689 molybdate ion transport Yes
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0008509 anion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 55 77 22
3 97 119 22
4 134 156 22
5 183 202 19
6 231 253 22
7 266 286 20
8 301 323 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 101.07 57.39 144.76
Alive In ants, during behavior modification 76.94 43.35 110.54
Dead In ants, recently dead 88.53 50.66 126.39

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.159900 no
Alive Dead 0.431054 no
Dead Fungus 0.526884 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00925
MLSAWLARLRRVNRHNLVTFRRAPIAEISGSLGDLGTLLPLMIALAVDGYIQLGATLVFSGLFNILTGLTFGIPL
PVQPMKAIASAAISGRENPSMGVVAAAGQWVAIAVLFMSVTGLLRWAAHVVPVPVVKGIQLGAGLSLILGAGTSL
LQPLGWVRPVLDNRVWALFAFLVLIATQRWSRFPYALCFFLLAMVFALITVLSSEGSLPRFHFWHPRHVMPRWLG
RHDAPALWMAIGQLPLTTLNSIIAVCALAADLLPDLPQPTVTAVGLSVALMNLSGTWFGAMPVCHGAGGLAAQYR
FGARSGASVIFLGLVKLVLGLVFGETLVDVLRGYPKSLLGIMVLAAGLELAKVGHSLNQGASDLWRNAADGDGSS
SMARRHRDLGEDERLERWTVMLMTTAGILAFRNDAVGFLAGMLCHGAYRLSPWLSKRISGGSGRSTEVDPLLRR*
Coding >Ophcf2|00925
ATGCTGTCTGCGTGGCTGGCTCGTCTCCGCCGCGTCAACCGGCACAACCTCGTCACCTTTCGCCGCGCGCCCATC
GCCGAAATCTCAGGCTCTCTCGGCGATCTCGGCACGCTGCTGCCGCTCATGATCGCCCTCGCCGTCGATGGCTAC
ATCCAGCTCGGCGCGACCCTAGTCTTTTCTGGCCTTTTCAACATCCTCACCGGTCTGACCTTTGGCATCCCCCTT
CCCGTCCAGCCCATGAAGGCTATAGCTTCGGCAGCCATCTCTGGTCGCGAGAATCCGTCCATGGGCGTCGTCGCC
GCCGCCGGCCAGTGGGTCGCCATCGCGGTGCTGTTCATGAGCGTCACCGGCCTACTGCGTTGGGCCGCACACGTC
GTGCCCGTGCCTGTCGTCAAGGGCATCCAGCTCGGCGCCGGCCTGTCTCTGATTCTCGGCGCCGGGACGTCCCTT
CTGCAGCCCCTGGGTTGGGTGCGCCCCGTGCTGGACAACCGGGTCTGGGCCTTGTTCGCCTTCCTCGTGCTCATC
GCCACTCAGCGGTGGTCCCGCTTCCCCTATGCGCTATGCTTCTTTCTCCTCGCCATGGTGTTCGCCCTTATCACC
GTCCTATCGTCCGAGGGCTCTCTACCTCGTTTCCACTTCTGGCATCCTCGCCATGTCATGCCCAGGTGGCTGGGT
CGTCACGACGCACCAGCTCTGTGGATGGCCATCGGACAGCTACCTCTGACGACACTCAACTCCATCATCGCCGTC
TGCGCTCTTGCCGCCGATCTCCTCCCTGACCTGCCTCAGCCGACCGTCACAGCTGTTGGTCTGAGCGTCGCTCTG
ATGAATCTCTCCGGCACGTGGTTTGGAGCCATGCCCGTTTGCCACGGGGCGGGAGGGCTCGCCGCTCAGTACCGC
TTCGGGGCGCGCAGCGGGGCCAGCGTCATCTTTCTTGGTCTCGTTAAGCTCGTGCTGGGCCTGGTTTTTGGCGAG
ACGCTCGTCGACGTGCTTCGCGGGTACCCCAAGAGCCTTCTAGGCATCATGGTCCTTGCTGCCGGCCTTGAACTG
GCCAAGGTCGGTCACTCGCTCAACCAGGGCGCTTCTGACCTGTGGCGGAACGCGGCCGATGGCGACGGCTCCTCA
TCCATGGCGAGGAGGCACCGCGACCTCGGCGAGGATGAGCGGCTCGAGAGGTGGACTGTGATGCTCATGACGACG
GCGGGTATCTTGGCCTTTCGCAACGACGCCGTCGGCTTTCTCGCCGGCATGCTGTGCCACGGAGCCTACAGGCTT
TCACCCTGGCTGTCGAAGCGCATCTCTGGAGGCTCGGGCCGATCTACCGAGGTGGACCCGTTGCTGCGGAGGTGA
Transcript >Ophcf2|00925
ATGCTGTCTGCGTGGCTGGCTCGTCTCCGCCGCGTCAACCGGCACAACCTCGTCACCTTTCGCCGCGCGCCCATC
GCCGAAATCTCAGGCTCTCTCGGCGATCTCGGCACGCTGCTGCCGCTCATGATCGCCCTCGCCGTCGATGGCTAC
ATCCAGCTCGGCGCGACCCTAGTCTTTTCTGGCCTTTTCAACATCCTCACCGGTCTGACCTTTGGCATCCCCCTT
CCCGTCCAGCCCATGAAGGCTATAGCTTCGGCAGCCATCTCTGGTCGCGAGAATCCGTCCATGGGCGTCGTCGCC
GCCGCCGGCCAGTGGGTCGCCATCGCGGTGCTGTTCATGAGCGTCACCGGCCTACTGCGTTGGGCCGCACACGTC
GTGCCCGTGCCTGTCGTCAAGGGCATCCAGCTCGGCGCCGGCCTGTCTCTGATTCTCGGCGCCGGGACGTCCCTT
CTGCAGCCCCTGGGTTGGGTGCGCCCCGTGCTGGACAACCGGGTCTGGGCCTTGTTCGCCTTCCTCGTGCTCATC
GCCACTCAGCGGTGGTCCCGCTTCCCCTATGCGCTATGCTTCTTTCTCCTCGCCATGGTGTTCGCCCTTATCACC
GTCCTATCGTCCGAGGGCTCTCTACCTCGTTTCCACTTCTGGCATCCTCGCCATGTCATGCCCAGGTGGCTGGGT
CGTCACGACGCACCAGCTCTGTGGATGGCCATCGGACAGCTACCTCTGACGACACTCAACTCCATCATCGCCGTC
TGCGCTCTTGCCGCCGATCTCCTCCCTGACCTGCCTCAGCCGACCGTCACAGCTGTTGGTCTGAGCGTCGCTCTG
ATGAATCTCTCCGGCACGTGGTTTGGAGCCATGCCCGTTTGCCACGGGGCGGGAGGGCTCGCCGCTCAGTACCGC
TTCGGGGCGCGCAGCGGGGCCAGCGTCATCTTTCTTGGTCTCGTTAAGCTCGTGCTGGGCCTGGTTTTTGGCGAG
ACGCTCGTCGACGTGCTTCGCGGGTACCCCAAGAGCCTTCTAGGCATCATGGTCCTTGCTGCCGGCCTTGAACTG
GCCAAGGTCGGTCACTCGCTCAACCAGGGCGCTTCTGACCTGTGGCGGAACGCGGCCGATGGCGACGGCTCCTCA
TCCATGGCGAGGAGGCACCGCGACCTCGGCGAGGATGAGCGGCTCGAGAGGTGGACTGTGATGCTCATGACGACG
GCGGGTATCTTGGCCTTTCGCAACGACGCCGTCGGCTTTCTCGCCGGCATGCTGTGCCACGGAGCCTACAGGCTT
TCACCCTGGCTGTCGAAGCGCATCTCTGGAGGCTCGGGCCGATCTACCGAGGTGGACCCGTTGCTGCGGAGGTGA
Gene >Ophcf2|00925
ATGCTGTCTGCGTGGCTGGCTCGTCTCCGCCGCGTCAACCGGCACAACCTCGTCACCTTTCGCCGCGCGCCCATC
GCCGAAATCTCAGGCTCTCTCGGCGATCTCGGCACGCTGCTGCCGCTCATGATCGCCCTCGCCGTCGATGGCTAC
ATCCAGCTCGGCGCGACCCTAGTCTTTTCTGGCCTTTTCAACATCCTCACCGGTCTGACCTTTGGCATCCCCCTT
CCCGTCCAGCCCATGAAGGTGAGAGAAGCTACCTGGGCGTCGTCATCGTCGGCGAGCGAGCGGCTGAGTTCTATC
ACGTAGGCTATAGCTTCGGCAGCCATCTCTGGTCGCGAGAATCCGTCCATGGGCGTCGTCGCCGCCGCCGGCCAG
TGGGTCGCCATCGCGGTGCTGTTCATGAGCGTCACCGGCCTACTGCGTTGGGCCGCACACGTCGTGCCCGTGCCT
GTCGTCAAGGGCATCCAGCTCGGCGCCGGCCTGTCTCTGATTCTCGGCGCCGGGACGTCCCTTCTGCAGCCCCTG
GGTTGGGTGCGCCCCGTGCTGGACAACCGGGTCTGGGCCTTGTTCGCCTTCCTCGTGCTCATCGCCACTCAGCGG
TGGTCCCGCTTCCCCTATGCGCTATGCTTCTTTCTCCTCGCCATGGTGTTCGCCCTTATCACCGTCCTATCGTCC
GAGGGCTCTCTACCTCGTTTCCACTTCTGGCATCCTCGCCATGTCATGCCCAGGTGGCTGGGTCGTCACGACGCA
CCAGCTCTGTGGATGGCCATCGGACAGCTACCTCTGACGACACTCAACTCCATCATCGCCGTCTGCGCTCTTGCC
GCCGATCTCCTCCCTGACCTGCCTCAGCCGACCGTCACAGCTGTTGGTCTGAGCGTCGCTCTGATGAATCTCTCC
GGCACGTGGTTTGGAGCCATGCCCGTTTGCCACGGGGCGGGAGGGCTCGCCGCTCAGTACCGCTTCGGGGCGCGC
AGCGGGGCCAGCGTCATCTTTCTTGGTCTCGTTAAGCTCGTGCTGGGCCTGGTTTTTGGCGAGACGCTCGTCGAC
GTGCTTCGCGGGTACCCCAAGAGCCTTCTAGGCATCATGGTCCTTGCTGCCGGCCTTGAACTGGCCAAGGTCGGT
CACTCGCTCAACCAGGGCGCTTCTGACCTGTGGCGGAACGCGGCCGATGGCGACGGCTCCTCATCCATGGCGAGG
AGGCACCGCGACCTCGGCGAGGATGAGCGGCTCGAGAGGTGGACTGTGATGCTCATGACGACGGCGGGTATCTTG
GCCTTTCGCAACGACGCCGTCGGCTTTCTCGCCGGCATGCTGTGCCACGGAGCCTACAGGCTTTCACCCTGGCTG
TCGAAGCGCATCTCTGGAGGCTCGGGCCGATCTACCGAGGTGGACCCGTTGCTGCGGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail