Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00925
Gene name
Locationscaffold_01:3509453..3510866
Strand+
Gene length (bp)1413
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16983 MFS_MOT1 Molybdate transporter of MFS superfamily 2.2E-25 26 142
PF16983 MFS_MOT1 Molybdate transporter of MFS superfamily 1.7E-35 232 350

GO

GO Term Description Terminal node
GO:0015689 molybdate ion transport Yes
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0008509 anion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 55 77 22
3 97 119 22
4 134 156 22
5 183 202 19
6 231 253 22
7 266 286 20
8 301 323 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00925
MLSAWLARLRRVNRHNLVTFRRAPIAEISGSLGDLGTLLPLMIALAVDGYIQLGATLVFSGLFNILTGLTFGIPL
PVQPMKAIASAAISGRENPSMGVVAAAGQWVAIAVLFMSVTGLLRWAAHVVPVPVVKGIQLGAGLSLILGAGTSL
LQPLGWVRPVLDNRVWALFAFLVLIATQRWSRFPYALCFFLLAMVFALITVLSSEGSLPRFHFWHPRHVMPRWLG
RHDAPALWMAIGQLPLTTLNSIIAVCALAADLLPDLPQPTVTAVGLSVALMNLSGTWFGAMPVCHGAGGLAAQYR
FGARSGASVIFLGLVKLVLGLVFGETLVDVLRGYPKSLLGIMVLAAGLELAKVGHSLNQGASDLWRNAADGDGSS
SMARRHRDLGEDERLERWTVMLMTTAGILAFRNDAVGFLAGMLCHGAYRLSPWLSKRISGGSGRSTEVDPLLRR*
Coding >Ophcf2|00925
ATGCTGTCTGCGTGGCTGGCTCGTCTCCGCCGCGTCAACCGGCACAACCTCGTCACCTTTCGCCGCGCGCCCATC
GCCGAAATCTCAGGCTCTCTCGGCGATCTCGGCACGCTGCTGCCGCTCATGATCGCCCTCGCCGTCGATGGCTAC
ATCCAGCTCGGCGCGACCCTAGTCTTTTCTGGCCTTTTCAACATCCTCACCGGTCTGACCTTTGGCATCCCCCTT
CCCGTCCAGCCCATGAAGGCTATAGCTTCGGCAGCCATCTCTGGTCGCGAGAATCCGTCCATGGGCGTCGTCGCC
GCCGCCGGCCAGTGGGTCGCCATCGCGGTGCTGTTCATGAGCGTCACCGGCCTACTGCGTTGGGCCGCACACGTC
GTGCCCGTGCCTGTCGTCAAGGGCATCCAGCTCGGCGCCGGCCTGTCTCTGATTCTCGGCGCCGGGACGTCCCTT
CTGCAGCCCCTGGGTTGGGTGCGCCCCGTGCTGGACAACCGGGTCTGGGCCTTGTTCGCCTTCCTCGTGCTCATC
GCCACTCAGCGGTGGTCCCGCTTCCCCTATGCGCTATGCTTCTTTCTCCTCGCCATGGTGTTCGCCCTTATCACC
GTCCTATCGTCCGAGGGCTCTCTACCTCGTTTCCACTTCTGGCATCCTCGCCATGTCATGCCCAGGTGGCTGGGT
CGTCACGACGCACCAGCTCTGTGGATGGCCATCGGACAGCTACCTCTGACGACACTCAACTCCATCATCGCCGTC
TGCGCTCTTGCCGCCGATCTCCTCCCTGACCTGCCTCAGCCGACCGTCACAGCTGTTGGTCTGAGCGTCGCTCTG
ATGAATCTCTCCGGCACGTGGTTTGGAGCCATGCCCGTTTGCCACGGGGCGGGAGGGCTCGCCGCTCAGTACCGC
TTCGGGGCGCGCAGCGGGGCCAGCGTCATCTTTCTTGGTCTCGTTAAGCTCGTGCTGGGCCTGGTTTTTGGCGAG
ACGCTCGTCGACGTGCTTCGCGGGTACCCCAAGAGCCTTCTAGGCATCATGGTCCTTGCTGCCGGCCTTGAACTG
GCCAAGGTCGGTCACTCGCTCAACCAGGGCGCTTCTGACCTGTGGCGGAACGCGGCCGATGGCGACGGCTCCTCA
TCCATGGCGAGGAGGCACCGCGACCTCGGCGAGGATGAGCGGCTCGAGAGGTGGACTGTGATGCTCATGACGACG
GCGGGTATCTTGGCCTTTCGCAACGACGCCGTCGGCTTTCTCGCCGGCATGCTGTGCCACGGAGCCTACAGGCTT
TCACCCTGGCTGTCGAAGCGCATCTCTGGAGGCTCGGGCCGATCTACCGAGGTGGACCCGTTGCTGCGGAGGTGA
Transcript >Ophcf2|00925
ATGCTGTCTGCGTGGCTGGCTCGTCTCCGCCGCGTCAACCGGCACAACCTCGTCACCTTTCGCCGCGCGCCCATC
GCCGAAATCTCAGGCTCTCTCGGCGATCTCGGCACGCTGCTGCCGCTCATGATCGCCCTCGCCGTCGATGGCTAC
ATCCAGCTCGGCGCGACCCTAGTCTTTTCTGGCCTTTTCAACATCCTCACCGGTCTGACCTTTGGCATCCCCCTT
CCCGTCCAGCCCATGAAGGCTATAGCTTCGGCAGCCATCTCTGGTCGCGAGAATCCGTCCATGGGCGTCGTCGCC
GCCGCCGGCCAGTGGGTCGCCATCGCGGTGCTGTTCATGAGCGTCACCGGCCTACTGCGTTGGGCCGCACACGTC
GTGCCCGTGCCTGTCGTCAAGGGCATCCAGCTCGGCGCCGGCCTGTCTCTGATTCTCGGCGCCGGGACGTCCCTT
CTGCAGCCCCTGGGTTGGGTGCGCCCCGTGCTGGACAACCGGGTCTGGGCCTTGTTCGCCTTCCTCGTGCTCATC
GCCACTCAGCGGTGGTCCCGCTTCCCCTATGCGCTATGCTTCTTTCTCCTCGCCATGGTGTTCGCCCTTATCACC
GTCCTATCGTCCGAGGGCTCTCTACCTCGTTTCCACTTCTGGCATCCTCGCCATGTCATGCCCAGGTGGCTGGGT
CGTCACGACGCACCAGCTCTGTGGATGGCCATCGGACAGCTACCTCTGACGACACTCAACTCCATCATCGCCGTC
TGCGCTCTTGCCGCCGATCTCCTCCCTGACCTGCCTCAGCCGACCGTCACAGCTGTTGGTCTGAGCGTCGCTCTG
ATGAATCTCTCCGGCACGTGGTTTGGAGCCATGCCCGTTTGCCACGGGGCGGGAGGGCTCGCCGCTCAGTACCGC
TTCGGGGCGCGCAGCGGGGCCAGCGTCATCTTTCTTGGTCTCGTTAAGCTCGTGCTGGGCCTGGTTTTTGGCGAG
ACGCTCGTCGACGTGCTTCGCGGGTACCCCAAGAGCCTTCTAGGCATCATGGTCCTTGCTGCCGGCCTTGAACTG
GCCAAGGTCGGTCACTCGCTCAACCAGGGCGCTTCTGACCTGTGGCGGAACGCGGCCGATGGCGACGGCTCCTCA
TCCATGGCGAGGAGGCACCGCGACCTCGGCGAGGATGAGCGGCTCGAGAGGTGGACTGTGATGCTCATGACGACG
GCGGGTATCTTGGCCTTTCGCAACGACGCCGTCGGCTTTCTCGCCGGCATGCTGTGCCACGGAGCCTACAGGCTT
TCACCCTGGCTGTCGAAGCGCATCTCTGGAGGCTCGGGCCGATCTACCGAGGTGGACCCGTTGCTGCGGAGGTGA
Gene >Ophcf2|00925
ATGCTGTCTGCGTGGCTGGCTCGTCTCCGCCGCGTCAACCGGCACAACCTCGTCACCTTTCGCCGCGCGCCCATC
GCCGAAATCTCAGGCTCTCTCGGCGATCTCGGCACGCTGCTGCCGCTCATGATCGCCCTCGCCGTCGATGGCTAC
ATCCAGCTCGGCGCGACCCTAGTCTTTTCTGGCCTTTTCAACATCCTCACCGGTCTGACCTTTGGCATCCCCCTT
CCCGTCCAGCCCATGAAGGTGAGAGAAGCTACCTGGGCGTCGTCATCGTCGGCGAGCGAGCGGCTGAGTTCTATC
ACGTAGGCTATAGCTTCGGCAGCCATCTCTGGTCGCGAGAATCCGTCCATGGGCGTCGTCGCCGCCGCCGGCCAG
TGGGTCGCCATCGCGGTGCTGTTCATGAGCGTCACCGGCCTACTGCGTTGGGCCGCACACGTCGTGCCCGTGCCT
GTCGTCAAGGGCATCCAGCTCGGCGCCGGCCTGTCTCTGATTCTCGGCGCCGGGACGTCCCTTCTGCAGCCCCTG
GGTTGGGTGCGCCCCGTGCTGGACAACCGGGTCTGGGCCTTGTTCGCCTTCCTCGTGCTCATCGCCACTCAGCGG
TGGTCCCGCTTCCCCTATGCGCTATGCTTCTTTCTCCTCGCCATGGTGTTCGCCCTTATCACCGTCCTATCGTCC
GAGGGCTCTCTACCTCGTTTCCACTTCTGGCATCCTCGCCATGTCATGCCCAGGTGGCTGGGTCGTCACGACGCA
CCAGCTCTGTGGATGGCCATCGGACAGCTACCTCTGACGACACTCAACTCCATCATCGCCGTCTGCGCTCTTGCC
GCCGATCTCCTCCCTGACCTGCCTCAGCCGACCGTCACAGCTGTTGGTCTGAGCGTCGCTCTGATGAATCTCTCC
GGCACGTGGTTTGGAGCCATGCCCGTTTGCCACGGGGCGGGAGGGCTCGCCGCTCAGTACCGCTTCGGGGCGCGC
AGCGGGGCCAGCGTCATCTTTCTTGGTCTCGTTAAGCTCGTGCTGGGCCTGGTTTTTGGCGAGACGCTCGTCGAC
GTGCTTCGCGGGTACCCCAAGAGCCTTCTAGGCATCATGGTCCTTGCTGCCGGCCTTGAACTGGCCAAGGTCGGT
CACTCGCTCAACCAGGGCGCTTCTGACCTGTGGCGGAACGCGGCCGATGGCGACGGCTCCTCATCCATGGCGAGG
AGGCACCGCGACCTCGGCGAGGATGAGCGGCTCGAGAGGTGGACTGTGATGCTCATGACGACGGCGGGTATCTTG
GCCTTTCGCAACGACGCCGTCGGCTTTCTCGCCGGCATGCTGTGCCACGGAGCCTACAGGCTTTCACCCTGGCTG
TCGAAGCGCATCTCTGGAGGCTCGGGCCGATCTACCGAGGTGGACCCGTTGCTGCGGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail