Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00923
Gene name
Locationscaffold_01:3499615..3501323
Strand-
Gene length (bp)1708
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06863 DUF1254 Protein of unknown function (DUF1254) 2.1E-21 89 211
PF06742 DUF1214 Protein of unknown function (DUF1214) 1.8E-16 371 482

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2364 0.0797 0.8932 0.0649 0.1458 0.0333 0.1617 0.2024 0.2436 0.0292

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999721

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|513
Ophiocordyceps australis map64 (Brazil) OphauB2|5354
Ophiocordyceps camponoti-floridani Ophcf2|00923 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|512
Ophiocordyceps kimflemingae Ophio5|4563
Ophiocordyceps kimflemingae Ophio5|7261
Ophiocordyceps subramaniannii Hirsu2|252
Ophiocordyceps subramaniannii Hirsu2|4440
Ophiocordyceps subramaniannii Hirsu2|6269
Ophiocordyceps subramaniannii Hirsu2|6270

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00923
MKLTSFSLALGALLCTSHALPAASDSDDDSFQDVNATAFAITYGYPLARYVATAEPLLAAVGINAWKHQRNPVRA
DEDDDEDERFPSALPNDHVLYSAAAIDLSTTDVVLTLPKIGGGRFYIISFYDLWSNNLANLGTLSMSSSGKYLLR
VSNKPWDVGLVNADEGTTDYIGYINIPTLYGLAIPQIRVRSNNETDLEAAREAQAAIKLTPEPRSGPGFGPRLSE
QLLGNGVLAELADKKAGKLRPHDARELLSVVARVDPFNRPWWPKEAAYVTRQLQDAGLEQGSYDPPSDVDYEAAI
RIVDRDVQKAETQLEAYGNGWFSFPHASTGVFGDAYPLRSLAAWLDPLQLAPSEVLSVFWLGDGGQMGARNGLTL
DNDDSLLVTFGAGKPPVTVSGFWTLALYDEEGGLIPNHLNRYSLGDLSNLTYADGLPVYGMSNRTEAFSILIQPL
DVLPPAKWTNNWLPAPVRGDKFFIHLRFFGPKLPLNANSSYAYPTVTRQRAIVA*
Coding >Ophcf2|00923
ATGAAGTTGACGAGCTTCAGCCTGGCCCTTGGAGCCCTCCTCTGCACCAGCCACGCTCTTCCCGCGGCTTCAGAC
AGTGATGACGACTCCTTCCAGGATGTCAACGCCACGGCTTTTGCTATAACGTACGGCTACCCTCTGGCCCGCTAC
GTGGCGACTGCAGAACCGTTGCTGGCGGCCGTGGGAATAAATGCCTGGAAGCATCAGAGGAATCCGGTGCGAGCG
GATGAAGATGATGACGAGGACGAACGGTTTCCCTCGGCTCTTCCTAATGACCATGTGCTCTACTCTGCTGCCGCC
ATTGATCTTTCGACGACTGATGTGGTCCTGACACTGCCCAAGATTGGCGGTGGTCGGTTCTATATCATATCCTTC
TACGACCTCTGGTCAAACAACCTCGCAAACCTTGGCACCCTCTCCATGAGCTCCTCAGGAAAGTATCTGCTCCGA
GTCTCCAATAAGCCGTGGGACGTCGGTCTGGTCAACGCAGATGAAGGCACGACAGACTACATCGGCTACATCAAC
ATCCCCACGCTCTACGGGCTGGCCATCCCCCAGATCCGCGTGCGCAGCAACAACGAAACCGACCTCGAAGCCGCG
CGGGAAGCCCAAGCCGCTATCAAGCTCACGCCTGAGCCTCGGTCCGGACCCGGTTTCGGCCCCCGGCTCTCGGAG
CAACTGCTCGGTAACGGAGTCCTTGCCGAGCTGGCGGATAAGAAGGCCGGAAAGCTTCGGCCTCATGACGCGCGT
GAACTCCTTTCTGTTGTGGCACGAGTCGACCCCTTTAACCGCCCCTGGTGGCCCAAGGAAGCTGCCTATGTGACG
CGTCAGCTCCAAGATGCGGGCCTCGAGCAGGGCTCATACGATCCGCCCTCCGACGTCGACTACGAAGCAGCCATC
CGTATCGTCGACCGAGACGTCCAGAAGGCAGAGACGCAGCTCGAGGCGTACGGAAACGGCTGGTTCAGCTTCCCT
CATGCCTCGACCGGTGTCTTCGGCGATGCTTACCCCCTTCGCTCCCTCGCCGCTTGGCTCGACCCCCTGCAGCTG
GCTCCCTCCGAGGTCCTCTCCGTGTTCTGGCTCGGCGATGGAGGTCAAATGGGCGCAAGAAACGGTCTGACGCTC
GACAACGACGACTCTCTGCTCGTCACCTTTGGGGCTGGGAAGCCTCCCGTCACTGTTAGTGGTTTCTGGACCCTA
GCTCTCTATGACGAAGAGGGTGGCCTTATCCCCAACCACCTTAATCGCTACTCTCTCGGTGATTTGAGCAATTTG
ACGTACGCAGACGGCCTGCCCGTTTACGGCATGTCGAACCGCACCGAGGCCTTTTCCATCCTGATTCAGCCGCTT
GATGTGCTCCCTCCGGCGAAATGGACGAATAACTGGCTCCCTGCCCCAGTCCGAGGCGACAAGTTTTTCATCCAT
CTTCGTTTCTTTGGCCCGAAACTGCCGCTTAACGCCAATTCTTCTTATGCTTACCCTACCGTCACCAGGCAACGA
GCCATTGTTGCTTAA
Transcript >Ophcf2|00923
ATGAAGTTGACGAGCTTCAGCCTGGCCCTTGGAGCCCTCCTCTGCACCAGCCACGCTCTTCCCGCGGCTTCAGAC
AGTGATGACGACTCCTTCCAGGATGTCAACGCCACGGCTTTTGCTATAACGTACGGCTACCCTCTGGCCCGCTAC
GTGGCGACTGCAGAACCGTTGCTGGCGGCCGTGGGAATAAATGCCTGGAAGCATCAGAGGAATCCGGTGCGAGCG
GATGAAGATGATGACGAGGACGAACGGTTTCCCTCGGCTCTTCCTAATGACCATGTGCTCTACTCTGCTGCCGCC
ATTGATCTTTCGACGACTGATGTGGTCCTGACACTGCCCAAGATTGGCGGTGGTCGGTTCTATATCATATCCTTC
TACGACCTCTGGTCAAACAACCTCGCAAACCTTGGCACCCTCTCCATGAGCTCCTCAGGAAAGTATCTGCTCCGA
GTCTCCAATAAGCCGTGGGACGTCGGTCTGGTCAACGCAGATGAAGGCACGACAGACTACATCGGCTACATCAAC
ATCCCCACGCTCTACGGGCTGGCCATCCCCCAGATCCGCGTGCGCAGCAACAACGAAACCGACCTCGAAGCCGCG
CGGGAAGCCCAAGCCGCTATCAAGCTCACGCCTGAGCCTCGGTCCGGACCCGGTTTCGGCCCCCGGCTCTCGGAG
CAACTGCTCGGTAACGGAGTCCTTGCCGAGCTGGCGGATAAGAAGGCCGGAAAGCTTCGGCCTCATGACGCGCGT
GAACTCCTTTCTGTTGTGGCACGAGTCGACCCCTTTAACCGCCCCTGGTGGCCCAAGGAAGCTGCCTATGTGACG
CGTCAGCTCCAAGATGCGGGCCTCGAGCAGGGCTCATACGATCCGCCCTCCGACGTCGACTACGAAGCAGCCATC
CGTATCGTCGACCGAGACGTCCAGAAGGCAGAGACGCAGCTCGAGGCGTACGGAAACGGCTGGTTCAGCTTCCCT
CATGCCTCGACCGGTGTCTTCGGCGATGCTTACCCCCTTCGCTCCCTCGCCGCTTGGCTCGACCCCCTGCAGCTG
GCTCCCTCCGAGGTCCTCTCCGTGTTCTGGCTCGGCGATGGAGGTCAAATGGGCGCAAGAAACGGTCTGACGCTC
GACAACGACGACTCTCTGCTCGTCACCTTTGGGGCTGGGAAGCCTCCCGTCACTGTTAGTGGTTTCTGGACCCTA
GCTCTCTATGACGAAGAGGGTGGCCTTATCCCCAACCACCTTAATCGCTACTCTCTCGGTGATTTGAGCAATTTG
ACGTACGCAGACGGCCTGCCCGTTTACGGCATGTCGAACCGCACCGAGGCCTTTTCCATCCTGATTCAGCCGCTT
GATGTGCTCCCTCCGGCGAAATGGACGAATAACTGGCTCCCTGCCCCAGTCCGAGGCGACAAGTTTTTCATCCAT
CTTCGTTTCTTTGGCCCGAAACTGCCGCTTAACGCCAATTCTTCTTATGCTTACCCTACCGTCACCAGGCAACGA
GCCATTGTTGCTTAA
Gene >Ophcf2|00923
ATGAAGTTGACGAGCTTCAGCCTGGCCCTTGGAGCCCTCCTCTGCACCAGCCACGCTCTTCCCGCGGCTTCAGAC
AGTGATGACGACTCCTTCCAGGATGTCAACGCCACGGCTTTTGCTATAACGGTGAGCCTCGTGTCTGCCGCTGAT
GCGCGTGCCGGCTAACCAGCTGTGTCTGAACAGTACGGCTACCCTCTGGCCCGCTACGTGGCGACTGCAGAACCG
TTGCTGGCGGCCGTGGGAATAAATGCCTGGAAGCATCAGAGGAATCCGGTGCGAGCGGATGAAGATGATGACGAG
GACGAACGGTTTCCCTCGGCTCTTCCTAATGACCATGTGCTCTACTCTGCTGCCGCCATTGATCTTTCGACGACT
GATGTGGTCCTGACACTGCCCAAGATTGGCGGTGGTCGGTTCTATATCATATCCTTCTACGACCTGTAAGTCTTG
TCAAGATGGACAATGATTTCCCCCTTTTCACCCCCTGACTCCAACCCTACCACTCACGCTATCCAACCCCTTTTA
GCTGGTCAAACAACCTCGCAAACCTTGGCACCCTCTCCATGAGCTCCTCAGGAAAGTATCTGCTCCGAGTCTCCA
ATAAGCCGTGGGACGTCGGTCTGGTCAACGCAGATGAAGGCACGACAGACTACATCGGCTACATCAACATCCCCA
CGCTCTACGGGCTGGCCATCCCCCAGATCCGCGTGCGCAGCAACAACGAAACCGACCTCGAAGCCGCGCGGGAAG
CCCAAGCCGCTATCAAGCTCACGCCTGAGCCTCGGTCCGGACCCGGTTTCGGCCCCCGGCTCTCGGAGCAACTGC
TCGGTAACGGAGTCCTTGCCGAGCTGGCGGATAAGAAGGCCGGAAAGCTTCGGCCTCATGACGCGCGTGAACTCC
TTTCTGTTGTGGCACGAGTCGACCCCTTTAACCGCCCCTGGTGGCCCAAGGAAGCTGCCTATGTGACGCGTCAGC
TCCAAGATGCGGGCCTCGAGCAGGGCTCATACGATCCGCCCTCCGACGTCGACTACGAAGCAGCCATCCGTATCG
TCGACCGAGACGTCCAGAAGGCAGAGACGCAGCTCGAGGCGTACGGAAACGGCTGGTTCAGCTTCCCTCATGCCT
CGACCGGTGTCTTCGGCGATGCTTACCCCCTTCGCTCCCTCGCCGCTTGGCTCGACCCCCTGCAGCTGGCTCCCT
CCGAGGTCCTCTCCGTGTTCTGGCTCGGCGATGGAGGTCAAATGGGCGCAAGAAACGGTCTGACGCTCGACAACG
ACGACTCTCTGCTCGTCACCTTTGGGGCTGGGAAGCCTCCCGTCACTGTTAGTGGTTTCTGGACCCTAGCTCTCT
ATGACGAAGAGGGTGGCCTTATCCCCAACCACCTTAATCGCTACTCTCTCGGTGATTTGAGCAATTTGACGTACG
CAGACGGCCTGCCCGTTTACGGCATGTCGAACCGCACCGAGGCCTTTTCCATCCTGATTCAGCCGCTTGATGTGC
TCCCTCCGGCGAAATGGACGAATAACTGGCTCCCTGCCCCAGTCCGAGGCGACAAGTTTTTCATCCATCGTGAGA
GTTCCGTTTGTTGTTGTCCGTGTCGAAGCTAATGTCGTTTGCAGTTCGTTTCTTTGGCCCGAAACTGCCGCTTAA
CGCCAATTCTTCTTATGCTTACCCTACCGTCACCAGGCAACGAGCCATTGTTGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail