Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00920
Gene name
Locationscaffold_01:3492877..3494529
Strand-
Gene length (bp)1652
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-40 46 442
PF00083 Sugar_tr Sugar (and other) transporter 4.3E-18 47 215

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 75 97 22
3 104 126 22
4 130 152 22
5 164 186 22
6 196 218 22
7 231 253 22
8 263 281 18
9 302 324 22
10 334 356 22
11 363 382 19
12 397 419 22
13 432 454 22
14 500 522 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00920
MSDNDSPQTCPETTSLLPKSTTDEERTIIVKDVSLARIALTMSTAWSSVFLAALDSTIVATLSAPISSEFHSLSL
FSWLATGYFISTAACQPISGRLTDIFGRGPGLAFCNLVFAAGNLICGLAANQYVIIVGRVVAGIGGGGLLSISTF
LASDLIPLRQRGLIGAIGNLWFGVGCMTGGVLGGILNDYTAMGWRLAFLIQVPPSMLCAIAVMLLVKVPPKQSDR
SHLARIDFVGVFLTSSFLVLLVFGLNAGGNLTPWAHPLPITSLLLSFLLFILFIWWESRARQPIIPVKLLLDRTV
SCACLTSLVVAMLANTAIFFVPLYLQILGETATSAGLRMLSSPVGMAFGALGSGYLMRRTGKFVGLGIASVLLLL
VGAVLLCLQGQETPATLTTAAFFFIGAGYSAVLSVTQIACIAAVDHSQQAVVTSITFLGRSLGGTAGITIVSAIY
QNTLDARLWWRFGDKPDAEAIIGRLRNDIGQLRHVPAEWRPGVVASFSEAFRYVWLTVLAWALLSIVCVSPIKQH
KLHSSLDRK*
Coding >Ophcf2|00920
ATGAGCGACAACGACTCCCCCCAAACATGCCCCGAAACGACAAGCCTCCTCCCCAAGTCAACGACGGACGAAGAG
CGAACCATCATCGTCAAGGATGTCTCCCTCGCCAGGATCGCCCTCACCATGAGCACCGCCTGGTCCAGCGTCTTC
CTCGCCGCCCTTGACTCCACCATCGTCGCCACACTATCAGCTCCCATCTCGAGCGAGTTCCACTCCCTCAGCCTC
TTCTCGTGGCTCGCTACCGGGTATTTCATCTCGACGGCTGCCTGCCAGCCTATATCGGGCCGTCTGACCGACATC
TTTGGCCGCGGGCCTGGTCTCGCCTTTTGCAACCTCGTCTTTGCGGCTGGCAATCTCATCTGCGGCCTAGCTGCG
AACCAGTATGTCATCATCGTCGGACGTGTCGTTGCGGGTATCGGCGGCGGCGGTCTTCTAAGCATCTCTACCTTT
CTCGCCTCGGATCTGATACCCCTGAGGCAACGCGGCCTCATCGGGGCCATCGGCAACCTCTGGTTCGGCGTTGGC
TGTATGACTGGCGGTGTCCTGGGCGGCATTCTCAACGACTATACGGCTATGGGCTGGCGGCTTGCCTTCTTGATC
CAAGTCCCCCCCTCGATGCTGTGCGCTATAGCCGTGATGCTGCTGGTCAAGGTGCCGCCGAAGCAGTCTGACCGG
TCTCACCTTGCTAGGATCGACTTTGTCGGTGTTTTCCTCACCTCGTCCTTTCTCGTGCTCCTCGTCTTTGGCCTC
AACGCGGGAGGTAACCTGACTCCATGGGCTCATCCTTTACCCATCACCAGCCTACTACTCTCCTTTCTGCTCTTC
ATACTCTTCATCTGGTGGGAAAGCAGGGCTCGACAACCCATCATACCCGTAAAGCTACTCCTGGACCGCACCGTT
TCGTGCGCCTGTCTGACAAGCCTCGTCGTCGCCATGCTGGCCAACACAGCCATCTTCTTCGTCCCGCTCTACCTG
CAGATCCTCGGCGAGACGGCCACCAGCGCCGGTCTGAGGATGCTATCGTCGCCCGTCGGCATGGCCTTTGGCGCT
CTCGGCTCGGGCTACCTGATGAGACGGACGGGCAAGTTTGTCGGGCTGGGCATCGCCAGCGTGCTGCTGCTGCTG
GTGGGAGCCGTGCTGCTGTGTCTGCAGGGCCAGGAGACGCCGGCCACGCTGACGACGGCCGCCTTCTTCTTCATA
GGGGCCGGCTACAGCGCGGTGCTGTCGGTGACGCAGATCGCCTGTATCGCGGCCGTCGATCACTCGCAACAGGCC
GTCGTCACGTCCATTACATTCCTCGGCCGGAGCCTGGGAGGGACCGCGGGCATCACCATCGTGTCGGCCATCTAT
CAGAACACGCTCGACGCTCGGCTCTGGTGGCGATTCGGCGACAAGCCTGACGCCGAGGCCATCATCGGCCGGCTT
CGGAACGACATCGGCCAGCTGCGACATGTGCCGGCTGAGTGGCGTCCGGGCGTCGTGGCGTCGTTTTCCGAGGCC
TTTCGCTACGTCTGGTTGACTGTGCTCGCCTGGGCACTGCTGTCTATCGTCTGTGTTTCTCCCATCAAGCAGCAT
AAACTGCACTCGTCGCTGGACAGGAAATGA
Transcript >Ophcf2|00920
ATGAGCGACAACGACTCCCCCCAAACATGCCCCGAAACGACAAGCCTCCTCCCCAAGTCAACGACGGACGAAGAG
CGAACCATCATCGTCAAGGATGTCTCCCTCGCCAGGATCGCCCTCACCATGAGCACCGCCTGGTCCAGCGTCTTC
CTCGCCGCCCTTGACTCCACCATCGTCGCCACACTATCAGCTCCCATCTCGAGCGAGTTCCACTCCCTCAGCCTC
TTCTCGTGGCTCGCTACCGGGTATTTCATCTCGACGGCTGCCTGCCAGCCTATATCGGGCCGTCTGACCGACATC
TTTGGCCGCGGGCCTGGTCTCGCCTTTTGCAACCTCGTCTTTGCGGCTGGCAATCTCATCTGCGGCCTAGCTGCG
AACCAGTATGTCATCATCGTCGGACGTGTCGTTGCGGGTATCGGCGGCGGCGGTCTTCTAAGCATCTCTACCTTT
CTCGCCTCGGATCTGATACCCCTGAGGCAACGCGGCCTCATCGGGGCCATCGGCAACCTCTGGTTCGGCGTTGGC
TGTATGACTGGCGGTGTCCTGGGCGGCATTCTCAACGACTATACGGCTATGGGCTGGCGGCTTGCCTTCTTGATC
CAAGTCCCCCCCTCGATGCTGTGCGCTATAGCCGTGATGCTGCTGGTCAAGGTGCCGCCGAAGCAGTCTGACCGG
TCTCACCTTGCTAGGATCGACTTTGTCGGTGTTTTCCTCACCTCGTCCTTTCTCGTGCTCCTCGTCTTTGGCCTC
AACGCGGGAGGTAACCTGACTCCATGGGCTCATCCTTTACCCATCACCAGCCTACTACTCTCCTTTCTGCTCTTC
ATACTCTTCATCTGGTGGGAAAGCAGGGCTCGACAACCCATCATACCCGTAAAGCTACTCCTGGACCGCACCGTT
TCGTGCGCCTGTCTGACAAGCCTCGTCGTCGCCATGCTGGCCAACACAGCCATCTTCTTCGTCCCGCTCTACCTG
CAGATCCTCGGCGAGACGGCCACCAGCGCCGGTCTGAGGATGCTATCGTCGCCCGTCGGCATGGCCTTTGGCGCT
CTCGGCTCGGGCTACCTGATGAGACGGACGGGCAAGTTTGTCGGGCTGGGCATCGCCAGCGTGCTGCTGCTGCTG
GTGGGAGCCGTGCTGCTGTGTCTGCAGGGCCAGGAGACGCCGGCCACGCTGACGACGGCCGCCTTCTTCTTCATA
GGGGCCGGCTACAGCGCGGTGCTGTCGGTGACGCAGATCGCCTGTATCGCGGCCGTCGATCACTCGCAACAGGCC
GTCGTCACGTCCATTACATTCCTCGGCCGGAGCCTGGGAGGGACCGCGGGCATCACCATCGTGTCGGCCATCTAT
CAGAACACGCTCGACGCTCGGCTCTGGTGGCGATTCGGCGACAAGCCTGACGCCGAGGCCATCATCGGCCGGCTT
CGGAACGACATCGGCCAGCTGCGACATGTGCCGGCTGAGTGGCGTCCGGGCGTCGTGGCGTCGTTTTCCGAGGCC
TTTCGCTACGTCTGGTTGACTGTGCTCGCCTGGGCACTGCTGTCTATCGTCTGTGTTTCTCCCATCAAGCAGCAT
AAACTGCACTCGTCGCTGGACAGGAAATGA
Gene >Ophcf2|00920
ATGAGCGACAACGACTCCCCCCAAACATGCCCCGAAACGACAAGCCTCCTCCCCAAGTCAACGACGGACGAAGAG
CGAACCATCATCGTCAAGGATGTCTCCCTCGCCAGGATCGCCCTCACCATGAGCACCGCCTGGTCCAGCGTCTTC
CTCGCCGCCCTTGACTCCACCATCGTCGCCACACTATCAGCTCCCATCTCGAGCGAGTTCCACTCCCTCAGCCTC
TTCTCGTGGCTCGCTACCGGGTATTTCATCTCGACGGCTGCCTGCCAGCCTATATCGGGCCGTCTGACCGACATC
TTTGGCCGCGGGCCTGGTCTCGCCTTTTGCAACCTCGTCTTTGCGGCTGGCAATCTCATCTGCGGCCTAGCTGCG
AACCAGTATGTCATCATCGTCGGACGTGTCGTTGCGGGTATCGGCGGCGGCGGTCTTCTAAGCATCTCTACCTTT
CTCGCCTCGGATCTGATACCCCTGAGGCAACGCGGCCTCATCGGGGCCATCGGCAACCTCTGGTTCGGCGTTGGC
TGTATGACTGGCGGTGTCCTGGGCGGCATTCTCAACGACTATACGGCTATGGGCTGGCGGCTTGCCTTCTTGATC
CAAGTCCCCCCCTCGATGCTGTGCGCTATAGCCGTGATGCTGCTGGTCAAGGTGCCGCCGAAGCAGTCTGACCGG
TCTCACCTTGCTAGGATCGACTTTGTCGGTGTTTTCCTCACCTCGTCCTTTCTCGTGCTCCTCGTCTTTGGCCTC
AACGCGGGAGGTAACCTGACTCCATGGGCTCATCCTTTACCCATCACCAGCCTACTACTCTCCTTTCTGCTCTTC
ATACTCTTCATCTGGTGGGAAAGCAGGGCTCGACAACCCATCATACCCGTAAAGCTACTCCTGGACCGCACCGTT
TCGTGCGCCTGTCTGACAAGCCTCGTCGTCGCCATGCTGGCCAACACAGCCATCTTCTTCGTCCCGCTCTACCTG
CAGATCCTCGGCGAGACGGCCACCAGCGCCGGTCTGAGGATGCTATCGTCGCCCGTCGGCATGGCCTTTGGCGCT
CTCGGCTCGGGCTACCTGATGAGACGGACGGGCAAGTTTGTCGGGCTGGGCATCGCCAGCGTGCTGCTGCTGCTG
GTGGGAGCCGTGCTGCTGTGTCTGCAGGGCCAGGAGACGCCGGCCACGCTGACGACGGCCGCCTTCTTCTTCATA
GGGGCCGGCTACAGCGCGGTGCTGTCGGTGACGCAGATCGCCTGTATCGCGGCCGTCGATCACTCGCAACAGGCC
GTCGTCACGTCCATTACATGTAGGGAGGCCAACCCTACCACGAGATACAGCAGCTGACGACGGTAGTCCTCGGCC
GGAGCCTGGGAGGGACCGCGGGCATCACCATCGTGTCGGCCATCTATCAGAACACGCTCGACGCTCGGCTCTGGT
GGCGATTCGGCGACAAGCCTGACGCCGAGGCCATCATCGGCCGGCTTCGGAACGACATCGGCCAGCTGCGACATG
TGCCGGCTGAGTGGCGTCCGGGCGTCGTGGCGTCGTTTTCCGAGGCCTTTCGCTACGTCTGGTTGACTGTGCTCG
CCTGGGCACTGCTGTCTATCGTCTGTGTTTCTCCCATCAAGCAGCATAAACTGCACTCGTCGCTGGACAGGAAAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail