Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00916
Gene name
Locationscaffold_01:3483173..3486075
Strand+
Gene length (bp)2902
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 48 70 22
3 90 112 22
4 124 146 22
5 206 228 22
6 406 428 22
7 443 465 22
8 485 507 22
9 522 544 22
10 595 617 22
11 719 741 22
12 748 770 22
13 775 797 22
14 810 832 22
15 837 859 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00916
MEGRFPNRGPTVFAVTTATLLLATAFVGARIVCRHYIVRNVSWDDRVMALAWLIALFLSFTIDLGAVTGLGKHDA
DISERDLETLRRCEYVFSILYNPALMATKTSVLIFYLRLAKNTQVVLRYASWATLVVVNVSGLVLTFINIFQCSP
VGAAWMAGEDHQSSCIPLLTEFICAAPINIITDLAVLALPIPVLTGMRLPSRQKTILVLTFTVGIFVAIVDVIRI
YYLQRAVSNVFMAPSTRPEARFGGEADFAWNASLSLMWSAVEVNVGMACACVPALKPLIMKLLPSMLYDPDGTWG
STESRAPGDFLDTTPSRKWSSHAAPATPVLALGSIHTDDGPPVSVADFSPVPDAAHLGSPVPDAALAVRTPTTAT
TTGDHGVYFGFVNLAKPKSMLRAGAADSLRYCTVVSILFFLWGLSYGLLNSLNNAVAAVNRISTAKTLGLTSAYF
GGGYFFGPLLVGEWILRRDEHNRSKRHEKDGAENVGGFKATFIVGLCIYGIGTMIFWPSAVANSYGGFMLSNFVV
GFGLSVLEVGANAFMVLCGPPEYGETRLLLAQGVQAVGSVVSGVLADKVFFKGIARENPHDSMTLINVQWTYLGI
TLLCVVLGLFFFYMPLPEVSDDELQRSAGQLPVQPSKRSVCGLELRTVCLALAVFTQYAYVAAQESNNIFFRSLI
LSAVPEPSSSVRQRRAAGGAGHLGGLTDPNRPLGFAITMADFLLVGRAIFALSRFLLAFLTFLSVGRGRMPQPRT
YLAMSVSLCFLSSLVLVVRRPSNPMLLATCAAVFFLGEGPIWPLVFAIGLRGQGSRTKRAAAFITMGGAGPAFFP
FVMYGIVESGRTLQTAFVVVVALQVAMLLYPSFLGLSQDARRLVDPCSAVRRALQRQDEEEMTMDEFVARRHRTD
RRGLHRGGLLRQASRSFGARFVMAPRKLWQQADVEHSEGGSRSP*
Coding >Ophcf2|00916
ATGGAAGGGCGCTTTCCGAATCGTGGTCCAACCGTCTTCGCCGTCACCACCGCGACTCTTCTGCTCGCTACCGCC
TTCGTCGGCGCTCGCATCGTCTGTCGTCACTACATCGTCCGCAATGTGTCGTGGGATGACAGGGTCATGGCTTTG
GCCTGGCTCATCGCCTTGTTCCTCTCCTTCACCATCGACCTCGGTGCCGTCACGGGGCTGGGGAAGCACGACGCA
GACATATCAGAGCGTGATCTCGAAACGCTCCGCCGCTGCGAATATGTCTTTTCCATATTATACAACCCGGCCCTC
ATGGCAACCAAGACCAGCGTCTTGATCTTCTACCTGCGCCTCGCCAAAAACACCCAGGTCGTGCTGCGGTACGCC
TCGTGGGCCACCCTGGTCGTCGTCAACGTCTCGGGCCTCGTCCTCACCTTTATCAACATCTTCCAGTGCAGTCCC
GTCGGCGCTGCCTGGATGGCCGGCGAAGATCATCAATCATCGTGCATCCCGCTCCTCACAGAGTTCATCTGCGCC
GCTCCCATCAACATCATCACCGACCTGGCCGTCCTCGCCCTGCCCATACCCGTCCTAACCGGCATGCGCCTCCCT
TCGCGACAGAAGACGATTCTGGTGCTGACCTTTACCGTCGGCATCTTCGTCGCCATTGTTGACGTCATCCGCATC
TATTATCTTCAGCGCGCCGTCTCCAACGTCTTCATGGCGCCTTCGACCCGTCCCGAGGCGAGATTCGGAGGCGAG
GCCGACTTTGCGTGGAACGCCTCGCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGCC
TGCGTGCCGGCCCTCAAGCCCCTGATTATGAAGCTGCTGCCTTCAATGCTGTACGATCCGGACGGAACCTGGGGC
TCTACCGAGTCCAGGGCTCCTGGCGACTTTCTCGACACCACTCCCTCTCGCAAATGGTCGAGCCACGCCGCGCCG
GCGACTCCCGTACTGGCCCTCGGGTCCATCCATACCGATGACGGACCGCCGGTCAGCGTCGCCGACTTTTCCCCG
GTGCCGGACGCGGCCCACCTCGGCTCCCCGGTACCGGACGCGGCGCTCGCCGTGCGCACCCCGACGACAGCGACG
ACGACGGGCGATCATGGCGTGTACTTTGGCTTCGTCAACCTGGCCAAGCCCAAGAGCATGCTGAGGGCCGGCGCC
GCCGACTCGCTGCGGTACTGCACCGTCGTCTCCATCCTTTTCTTCCTCTGGGGTCTCTCGTACGGTCTCCTCAAC
AGCCTCAACAACGCCGTCGCCGCCGTCAACCGTATCTCGACGGCAAAGACACTGGGCTTGACCAGCGCCTACTTC
GGCGGCGGTTACTTCTTTGGCCCTCTGCTGGTGGGTGAATGGATCCTGCGCCGGGACGAGCACAACCGCTCCAAG
CGGCACGAAAAGGACGGCGCCGAGAACGTGGGCGGCTTCAAGGCGACCTTTATCGTCGGCCTGTGCATCTACGGC
ATCGGGACCATGATCTTCTGGCCCTCGGCCGTTGCCAACTCGTACGGCGGCTTCATGCTCAGCAACTTCGTCGTC
GGCTTCGGCCTCTCGGTGCTCGAGGTGGGCGCCAACGCCTTCATGGTGCTCTGCGGCCCGCCCGAATATGGCGAG
ACGCGGCTGCTGCTGGCACAAGGCGTCCAAGCTGTCGGGAGCGTCGTGAGCGGCGTACTGGCGGACAAGGTCTTC
TTCAAGGGCATCGCCCGCGAGAACCCTCACGACAGCATGACGCTCATCAACGTCCAGTGGACGTATCTCGGTATC
ACCCTGCTGTGTGTCGTCCTCGGCCTCTTCTTCTTCTACATGCCTCTGCCCGAGGTTAGCGACGACGAGCTGCAA
CGGTCGGCGGGCCAGCTGCCCGTCCAGCCGAGCAAGAGGAGCGTCTGCGGCCTCGAGCTGCGTACCGTCTGCCTG
GCGCTGGCCGTCTTCACCCAGTACGCCTACGTGGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGCCTCATC
CTCTCGGCCGTGCCCGAACCGTCGTCGTCGGTGAGGCAGCGCAGGGCGGCGGGCGGCGCGGGACACCTGGGGGGC
CTGACGGACCCGAACAGGCCGTTGGGCTTCGCCATCACAATGGCCGACTTTCTCCTGGTCGGACGCGCCATCTTC
GCCCTGTCGCGATTCTTGCTGGCCTTTCTCACCTTCTTGTCCGTCGGCCGTGGCCGGATGCCGCAACCTCGGACC
TACCTGGCCATGAGCGTGAGCTTATGCTTCTTGTCGTCGCTTGTGCTCGTCGTGCGTCGGCCGTCGAACCCGATG
CTACTCGCAACCTGCGCTGCCGTCTTCTTCTTGGGCGAGGGTCCGATATGGCCCCTCGTCTTCGCCATCGGCCTC
CGGGGTCAAGGCTCGAGGACGAAGCGTGCCGCGGCTTTCATCACCATGGGTGGCGCTGGGCCGGCCTTTTTCCCC
TTTGTCATGTACGGCATCGTCGAGAGCGGCAGGACGTTGCAGACAGCCTTTGTCGTCGTCGTCGCGCTGCAGGTG
GCCATGCTACTTTATCCCTCCTTCTTGGGGCTCAGCCAAGACGCGAGACGGCTAGTCGATCCGTGCTCGGCCGTT
CGACGGGCTCTGCAGAGGCAGGACGAGGAAGAGATGACGATGGACGAGTTCGTGGCCCGCAGGCACCGTACCGAT
CGGCGCGGGCTTCACAGGGGCGGGCTCTTGCGGCAGGCTTCCAGGAGCTTCGGCGCTAGATTCGTCATGGCTCCA
CGGAAACTATGGCAGCAGGCCGACGTGGAGCACAGCGAGGGCGGTAGTCGGAGCCCGTGA
Transcript >Ophcf2|00916
ATGGAAGGGCGCTTTCCGAATCGTGGTCCAACCGTCTTCGCCGTCACCACCGCGACTCTTCTGCTCGCTACCGCC
TTCGTCGGCGCTCGCATCGTCTGTCGTCACTACATCGTCCGCAATGTGTCGTGGGATGACAGGGTCATGGCTTTG
GCCTGGCTCATCGCCTTGTTCCTCTCCTTCACCATCGACCTCGGTGCCGTCACGGGGCTGGGGAAGCACGACGCA
GACATATCAGAGCGTGATCTCGAAACGCTCCGCCGCTGCGAATATGTCTTTTCCATATTATACAACCCGGCCCTC
ATGGCAACCAAGACCAGCGTCTTGATCTTCTACCTGCGCCTCGCCAAAAACACCCAGGTCGTGCTGCGGTACGCC
TCGTGGGCCACCCTGGTCGTCGTCAACGTCTCGGGCCTCGTCCTCACCTTTATCAACATCTTCCAGTGCAGTCCC
GTCGGCGCTGCCTGGATGGCCGGCGAAGATCATCAATCATCGTGCATCCCGCTCCTCACAGAGTTCATCTGCGCC
GCTCCCATCAACATCATCACCGACCTGGCCGTCCTCGCCCTGCCCATACCCGTCCTAACCGGCATGCGCCTCCCT
TCGCGACAGAAGACGATTCTGGTGCTGACCTTTACCGTCGGCATCTTCGTCGCCATTGTTGACGTCATCCGCATC
TATTATCTTCAGCGCGCCGTCTCCAACGTCTTCATGGCGCCTTCGACCCGTCCCGAGGCGAGATTCGGAGGCGAG
GCCGACTTTGCGTGGAACGCCTCGCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGCC
TGCGTGCCGGCCCTCAAGCCCCTGATTATGAAGCTGCTGCCTTCAATGCTGTACGATCCGGACGGAACCTGGGGC
TCTACCGAGTCCAGGGCTCCTGGCGACTTTCTCGACACCACTCCCTCTCGCAAATGGTCGAGCCACGCCGCGCCG
GCGACTCCCGTACTGGCCCTCGGGTCCATCCATACCGATGACGGACCGCCGGTCAGCGTCGCCGACTTTTCCCCG
GTGCCGGACGCGGCCCACCTCGGCTCCCCGGTACCGGACGCGGCGCTCGCCGTGCGCACCCCGACGACAGCGACG
ACGACGGGCGATCATGGCGTGTACTTTGGCTTCGTCAACCTGGCCAAGCCCAAGAGCATGCTGAGGGCCGGCGCC
GCCGACTCGCTGCGGTACTGCACCGTCGTCTCCATCCTTTTCTTCCTCTGGGGTCTCTCGTACGGTCTCCTCAAC
AGCCTCAACAACGCCGTCGCCGCCGTCAACCGTATCTCGACGGCAAAGACACTGGGCTTGACCAGCGCCTACTTC
GGCGGCGGTTACTTCTTTGGCCCTCTGCTGGTGGGTGAATGGATCCTGCGCCGGGACGAGCACAACCGCTCCAAG
CGGCACGAAAAGGACGGCGCCGAGAACGTGGGCGGCTTCAAGGCGACCTTTATCGTCGGCCTGTGCATCTACGGC
ATCGGGACCATGATCTTCTGGCCCTCGGCCGTTGCCAACTCGTACGGCGGCTTCATGCTCAGCAACTTCGTCGTC
GGCTTCGGCCTCTCGGTGCTCGAGGTGGGCGCCAACGCCTTCATGGTGCTCTGCGGCCCGCCCGAATATGGCGAG
ACGCGGCTGCTGCTGGCACAAGGCGTCCAAGCTGTCGGGAGCGTCGTGAGCGGCGTACTGGCGGACAAGGTCTTC
TTCAAGGGCATCGCCCGCGAGAACCCTCACGACAGCATGACGCTCATCAACGTCCAGTGGACGTATCTCGGTATC
ACCCTGCTGTGTGTCGTCCTCGGCCTCTTCTTCTTCTACATGCCTCTGCCCGAGGTTAGCGACGACGAGCTGCAA
CGGTCGGCGGGCCAGCTGCCCGTCCAGCCGAGCAAGAGGAGCGTCTGCGGCCTCGAGCTGCGTACCGTCTGCCTG
GCGCTGGCCGTCTTCACCCAGTACGCCTACGTGGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGCCTCATC
CTCTCGGCCGTGCCCGAACCGTCGTCGTCGGTGAGGCAGCGCAGGGCGGCGGGCGGCGCGGGACACCTGGGGGGC
CTGACGGACCCGAACAGGCCGTTGGGCTTCGCCATCACAATGGCCGACTTTCTCCTGGTCGGACGCGCCATCTTC
GCCCTGTCGCGATTCTTGCTGGCCTTTCTCACCTTCTTGTCCGTCGGCCGTGGCCGGATGCCGCAACCTCGGACC
TACCTGGCCATGAGCGTGAGCTTATGCTTCTTGTCGTCGCTTGTGCTCGTCGTGCGTCGGCCGTCGAACCCGATG
CTACTCGCAACCTGCGCTGCCGTCTTCTTCTTGGGCGAGGGTCCGATATGGCCCCTCGTCTTCGCCATCGGCCTC
CGGGGTCAAGGCTCGAGGACGAAGCGTGCCGCGGCTTTCATCACCATGGGTGGCGCTGGGCCGGCCTTTTTCCCC
TTTGTCATGTACGGCATCGTCGAGAGCGGCAGGACGTTGCAGACAGCCTTTGTCGTCGTCGTCGCGCTGCAGGTG
GCCATGCTACTTTATCCCTCCTTCTTGGGGCTCAGCCAAGACGCGAGACGGCTAGTCGATCCGTGCTCGGCCGTT
CGACGGGCTCTGCAGAGGCAGGACGAGGAAGAGATGACGATGGACGAGTTCGTGGCCCGCAGGCACCGTACCGAT
CGGCGCGGGCTTCACAGGGGCGGGCTCTTGCGGCAGGCTTCCAGGAGCTTCGGCGCTAGATTCGTCATGGCTCCA
CGGAAACTATGGCAGCAGGCCGACGTGGAGCACAGCGAGGGCGGTAGTCGGAGCCCGTGA
Gene >Ophcf2|00916
ATGGAAGGGCGCTTTCCGAATCGTGGTCCAACCGTCTTCGCCGTCACCACCGCGACTCTTCTGCTCGCTACCGCC
TTCGTCGGCGCTCGCATCGTCTGTCGTCACTACATCGTCCGCAATGTGTCGTGGGATGACAGGGTCATGGCTTTG
GCCTGGCTCATCGCCTTGTTCCTCTCCTTCACCATCGACCTCGGTGCCGTCACGGGGCTGGGGAAGCACGACGCA
GACATATCAGAGCGTGATCTCGAAACGCTCCGCCGCTGCGAATATGTCTTTTCCATATTATACGTGCGTTCTTCC
TGCAGTCCTGGCCTCTCGTCATGTCCGCTGACGGCTTACACGCATGTGTATGTAGAACCCGGCCCTCATGGCAAC
CAAGACCAGCGTCTTGATCTTCTACCTGCGCCTCGCCAAAAACACCCAGGTCGTGCTGCGGTACGCCTCGTGGGC
CACCCTGGTCGTCGTCAACGTCTCGGGCCTCGTCCTCACCTTTATCAACATCTTCCAGTGCAGTCCCGTCGGCGC
TGCCTGGATGGCCGGCGAAGATCATCAATCATCGTGCATCCCGCTCCTCACAGAGTTCATCTGCGCCGCTCCCAT
CAACATCATCACCGACCTGGCCGTCCTCGCCCTGCCCATACCCGTCCTAACCGGCATGCGCCTCCCTTCGCGACA
GAAGACGATTCTGGTGCTGACCTTTACCGTCGGCATCTTCGTCGCCATTGTTGACGTCATCCGCATCTATTATCT
TCAGCGCGCCGTCTCCAACGTCTTCATGGCGCCTTCGACCCGTCCCGAGGCGAGATTCGGAGGCGAGGCCGACTT
TGCGTGGAACGCCTCGCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGCCTGCGTGCC
GGCCCTCAAGCCCCTGATTATGAAGCTGCTGCCTTCAATGCTGTACGATCCGGACGGAACCTGGGGCTCTACCGA
GTCCAGGGCTCCTGGCGACTTTCTCGACACCACTCCCTCTCGCAAATGGTCGAGCCACGCCGCGCCGGCGACTCC
CGTACTGGCCCTCGGGTCCATCCATACCGATGACGGACCGCCGGTCAGCGTCGCCGACTTTTCCCCGGTGCCGGA
CGCGGCCCACCTCGGCTCCCCGGTACCGGACGCGGCGCTCGCCGTGCGCACCCCGACGACAGCGACGACGACGGG
CGATCATGGCGTGTACTTTGGCTTCGTCAACCTGGCCAAGCCCAAGAGCATGCTGAGGGCCGGCGCCGCCGACTC
GCTGCGGTACTGCACCGTCGTCTCCATCCTTTTCTTCCTCTGGGGTCTCTCGTACGGTCTCCTCAACAGCCTCAA
CAACGCCGTCGCCGCCGTCAACCGTATCTCGACGGCAAAGACACTGGGCTTGACCAGCGCCTACTTCGGCGGCGG
TTACTTCTTTGGCCCTCTGCTGGTGGGTGAATGGATCCTGCGCCGGGACGAGCACAACCGCTCCAAGCGGCACGA
AAAGGACGGCGCCGAGAACGTGGGCGGCTTCAAGGCGACCTTTATCGTCGGCCTGTGCATCTACGGCATCGGGAC
CATGATCTTCTGGCCCTCGGCCGTTGCCAACTCGTACGGCGGCTTCATGCTCAGCAACTTCGTCGTCGGCTTCGG
CCTCTCGGTGCTCGAGGTGGGCGCCAACGCCTTCATGGTGCTCTGCGGCCCGCCCGAATATGGCGAGACGCGGCT
GCTGCTGGCACAAGGCGTCCAAGCTGTCGGGAGCGTCGTGAGCGGCGTACTGGCGGACAAGGTCTTCTTCAAGGG
CATCGCCCGCGAGAACCCTCACGACAGCATGACGCTCATCAACGTCCAGTGGACGTATCTCGGTATCACCCTGCT
GTGTGTCGTCCTCGGCCTCTTCTTCTTCTACATGCCTCTGCCCGAGGTTAGCGACGACGAGCTGCAACGGTCGGC
GGGCCAGCTGCCCGTCCAGCCGAGCAAGAGGAGCGTCTGCGGCCTCGAGCTGCGTACCGTCTGCCTGGCGCTGGC
CGTCTTCACCCAGTACGCCTACGTGGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGCCTCATCCTCTCGGC
CGTGCCCGAACCGTCGTCGTCGGTGAGGCAGCGCAGGGCGGCGGGCGGCGCGGGACACCTGGGGGGCCTGACGGA
CCCGAACAGGCCGTTGGGCTTCGCCATCACAATGGCCGACTTTCTCCTGGTCGGACGCGCCATCTTCGCCCTGTC
GCGATTCTTGCTGGCCTTTCTCACCTTCTTGTCCGTCGGCCGTGGCCGGATGCCGCAACCTCGGACCTACCTGGC
CATGAGCGTGAGCTTATGCTTCTTGTCGTCGCTTGTGCTCGTCGTGCGTCGGCCGTCGAACCCGATGCTACTCGC
AACCTGCGCTGCCGTCTTCTTCTTGGGCGAGGGTCCGATATGGCCCCTCGTCTTCGCCATCGGCCTCCGGGGTCA
AGGCTCGAGGACGAAGCGTGCCGCGGCTTTCATCACCATGGGTGGCGCTGGGCCGGCCTTTTTCCCCTTTGTCAT
GTACGGCATCGTCGAGAGCGGCAGGACGTTGCAGACAGCCTTTGTCGTCGTCGTCGCGCTGCAGGTGGCCATGCT
ACTTTATCCCTCCTTCTTGGGGCTCAGCCAAGACGCGAGACGGCTAGTCGATCCGTGCTCGGCCGTTCGACGGGC
TCTGCAGAGGCAGGACGAGGAAGAGATGACGATGGACGAGTTCGTGGCCCGCAGGCACCGTACCGATCGGCGCGG
GCTTCACAGGGGCGGGCTCTTGCGGCAGGCTTCCAGGAGCTTCGGCGCTAGATTCGTCATGGCTCCACGGAAACT
ATGGCAGCAGGCCGACGTGGAGCACAGCGAGGGCGGTAGTCGGAGCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail