Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00915
Gene name
Locationscaffold_01:3480233..3482040
Strand+
Gene length (bp)1807
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.1E-53 37 478
PF00324 AA_permease Amino acid permease 3.5E-19 50 483

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 69 91 22
3 124 146 22
4 161 183 22
5 190 212 22
6 268 290 22
7 316 338 22
8 370 392 22
9 399 421 22
10 436 458 22
11 470 489 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 58.75 33.68 83.82
Alive In ants, during behavior modification 448.93 183.88 713.98
Dead In ants, recently dead 273.95 132.97 414.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.014008 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00915
MNGNSLKPHRTSCDDDAAALERLGHKQELKRNLSVMSMLGLAFAIVNTWTALAASLSVALPSGGCSAVVWGLLTS
GVCNMCLAASMAEFLSAYPTAGGQYHWAAIIAGRRAGRAVGFVTGWINVSGWVAISASGGLLGSTFILNAISLLH
PGYEPRSWHHFFLHTAITLFALAVNALGARLLPYVTNAALYWALGGLVLTSITIVSCTAPDFQGGAFVYGGFIND
VGWPDGLAWMLGLLQGSFALTGYDATAHMIEEMPDPQHHGPRVMLYAVGIGVVTGFFFVSCLLFCIHDVQQVVNA
PYGPLLQIYMDATKSVAGSICLVVIPIISVVFTTITLLSVTSRMIYAFARDRGMPFSSVFARVQPGLDVPLNALF
GVAGCCLVFGCILVGSSSAMNAITAAAVVALGVTYAIPPAINVIRGRRMLPADRPFKLSEPLGWTVNLVGIAWTA
LTTVLFVFPPRAPATPSNMNYCIVAFGIILLLAGLTWVLDGRRHYRGPQIDGLVTGTGFSLVDGIAEGVEKTKDG
QRTAGVTSETVSIEASEGTAQADGTTKKDV*
Coding >Ophcf2|00915
ATGAACGGAAACTCGCTCAAACCGCATAGGACGTCATGCGACGACGATGCCGCCGCGCTCGAACGCCTGGGCCAC
AAACAGGAGCTCAAGCGCAACTTGTCCGTGATGTCGATGCTCGGGCTGGCCTTTGCCATCGTCAACACCTGGACT
GCGCTCGCTGCCTCTCTCAGCGTGGCCTTGCCTTCGGGCGGTTGCAGCGCTGTCGTCTGGGGCTTGCTGACGTCG
GGTGTGTGTAACATGTGCCTCGCGGCGTCCATGGCAGAGTTCCTTTCTGCCTATCCTACAGCCGGGGGTCAGTAT
CACTGGGCTGCCATCATCGCCGGTCGTCGAGCTGGACGCGCTGTTGGCTTCGTTACCGGCTGGATCAACGTCTCG
GGCTGGGTGGCCATCAGCGCCTCGGGAGGCCTCCTGGGATCGACCTTTATTCTCAACGCCATCTCGCTGCTGCAT
CCGGGCTACGAGCCCCGATCGTGGCATCATTTCTTTCTCCATACCGCCATCACTCTCTTCGCGCTGGCCGTCAAC
GCCCTGGGCGCCAGGCTGTTGCCGTACGTGACCAACGCGGCGCTGTATTGGGCGCTGGGCGGTCTGGTCTTGACT
TCCATCACCATCGTGTCCTGTACGGCGCCCGACTTTCAAGGCGGTGCCTTTGTTTATGGCGGTTTCATCAACGAC
GTCGGCTGGCCCGACGGACTGGCTTGGATGCTGGGGCTGCTTCAGGGCTCGTTTGCGCTGACGGGCTACGACGCG
ACGGCTCACATGATCGAGGAGATGCCCGATCCTCAGCATCACGGCCCTCGCGTCATGCTCTACGCCGTCGGTATC
GGCGTCGTCACCGGCTTCTTCTTCGTCAGCTGCCTGCTCTTCTGCATCCATGACGTACAGCAGGTCGTCAACGCC
CCTTACGGCCCGCTGCTGCAGATATACATGGACGCCACCAAGAGCGTGGCCGGTAGCATCTGTCTCGTCGTCATC
CCCATCATCAGCGTCGTCTTTACCACAATCACCCTGCTCTCCGTCACCAGCCGCATGATCTACGCCTTTGCCCGC
GACAGGGGCATGCCCTTTAGCAGCGTCTTCGCCCGGGTCCAGCCGGGGCTCGACGTGCCGTTGAACGCCCTGTTT
GGGGTGGCCGGCTGCTGTCTCGTCTTTGGCTGCATCTTGGTGGGCTCCTCGAGCGCCATGAATGCCATCACGGCG
GCGGCGGTGGTGGCCCTAGGCGTCACCTACGCCATCCCTCCGGCCATCAACGTCATCCGGGGCCGCCGCATGTTA
CCGGCGGACCGACCTTTTAAGCTGTCGGAGCCACTGGGATGGACGGTGAACCTGGTGGGCATCGCCTGGACGGCA
TTGACGACGGTGCTCTTCGTCTTCCCTCCGCGAGCACCGGCGACGCCCAGCAACATGAACTACTGCATCGTCGCC
TTCGGCATCATCCTGCTGCTGGCCGGCCTGACGTGGGTGCTAGACGGACGACGACACTACCGCGGCCCTCAGATC
GACGGCCTGGTGACGGGCACGGGCTTCAGCTTGGTCGACGGCATCGCCGAGGGCGTCGAGAAGACCAAGGACGGG
CAGCGGACGGCGGGCGTCACGTCCGAGACGGTGTCCATCGAGGCCTCCGAGGGGACGGCTCAGGCTGATGGCACT
ACCAAGAAGGACGTCTAG
Transcript >Ophcf2|00915
ATGAACGGAAACTCGCTCAAACCGCATAGGACGTCATGCGACGACGATGCCGCCGCGCTCGAACGCCTGGGCCAC
AAACAGGAGCTCAAGCGCAACTTGTCCGTGATGTCGATGCTCGGGCTGGCCTTTGCCATCGTCAACACCTGGACT
GCGCTCGCTGCCTCTCTCAGCGTGGCCTTGCCTTCGGGCGGTTGCAGCGCTGTCGTCTGGGGCTTGCTGACGTCG
GGTGTGTGTAACATGTGCCTCGCGGCGTCCATGGCAGAGTTCCTTTCTGCCTATCCTACAGCCGGGGGTCAGTAT
CACTGGGCTGCCATCATCGCCGGTCGTCGAGCTGGACGCGCTGTTGGCTTCGTTACCGGCTGGATCAACGTCTCG
GGCTGGGTGGCCATCAGCGCCTCGGGAGGCCTCCTGGGATCGACCTTTATTCTCAACGCCATCTCGCTGCTGCAT
CCGGGCTACGAGCCCCGATCGTGGCATCATTTCTTTCTCCATACCGCCATCACTCTCTTCGCGCTGGCCGTCAAC
GCCCTGGGCGCCAGGCTGTTGCCGTACGTGACCAACGCGGCGCTGTATTGGGCGCTGGGCGGTCTGGTCTTGACT
TCCATCACCATCGTGTCCTGTACGGCGCCCGACTTTCAAGGCGGTGCCTTTGTTTATGGCGGTTTCATCAACGAC
GTCGGCTGGCCCGACGGACTGGCTTGGATGCTGGGGCTGCTTCAGGGCTCGTTTGCGCTGACGGGCTACGACGCG
ACGGCTCACATGATCGAGGAGATGCCCGATCCTCAGCATCACGGCCCTCGCGTCATGCTCTACGCCGTCGGTATC
GGCGTCGTCACCGGCTTCTTCTTCGTCAGCTGCCTGCTCTTCTGCATCCATGACGTACAGCAGGTCGTCAACGCC
CCTTACGGCCCGCTGCTGCAGATATACATGGACGCCACCAAGAGCGTGGCCGGTAGCATCTGTCTCGTCGTCATC
CCCATCATCAGCGTCGTCTTTACCACAATCACCCTGCTCTCCGTCACCAGCCGCATGATCTACGCCTTTGCCCGC
GACAGGGGCATGCCCTTTAGCAGCGTCTTCGCCCGGGTCCAGCCGGGGCTCGACGTGCCGTTGAACGCCCTGTTT
GGGGTGGCCGGCTGCTGTCTCGTCTTTGGCTGCATCTTGGTGGGCTCCTCGAGCGCCATGAATGCCATCACGGCG
GCGGCGGTGGTGGCCCTAGGCGTCACCTACGCCATCCCTCCGGCCATCAACGTCATCCGGGGCCGCCGCATGTTA
CCGGCGGACCGACCTTTTAAGCTGTCGGAGCCACTGGGATGGACGGTGAACCTGGTGGGCATCGCCTGGACGGCA
TTGACGACGGTGCTCTTCGTCTTCCCTCCGCGAGCACCGGCGACGCCCAGCAACATGAACTACTGCATCGTCGCC
TTCGGCATCATCCTGCTGCTGGCCGGCCTGACGTGGGTGCTAGACGGACGACGACACTACCGCGGCCCTCAGATC
GACGGCCTGGTGACGGGCACGGGCTTCAGCTTGGTCGACGGCATCGCCGAGGGCGTCGAGAAGACCAAGGACGGG
CAGCGGACGGCGGGCGTCACGTCCGAGACGGTGTCCATCGAGGCCTCCGAGGGGACGGCTCAGGCTGATGGCACT
ACCAAGAAGGACGTCTAG
Gene >Ophcf2|00915
ATGAACGGAAACTCGCTCAAACCGCATAGGACGTCATGCGACGACGATGCCGCCGCGCTCGAACGCCTGGGCCAC
AAACAGGAGCTCAAGCGCAACTTGTCCGTGATGTCGATGCTCGGGCTGGCCTTTGCCATCGTCAACACCTGGACT
GCGCTCGCTGCCTCTCTCAGCGTGGCCTTGCCTTCGGGCGGTTGCAGCGCTGTCGTCTGGGGCTTGCTGACGTCG
GGTGTGTGTAACATGTGCCTCGCGGCGTCCATGGCAGAGTTCCTTTCTGCCTATCCTACAGCCGGGGGTCAGTAT
CACTGGGCTGCCATCATCGCCGGTCGTCGAGCTGGACGCGCTGTTGGCTTCGTTACCGGCTGGATCAACGTCTCG
GGCTGGGTGGCCATCAGCGCCTCGGGAGGCCTCCTGGGATCGACCTTTATTCTCAACGCCATCTCGCTGCTGCAT
CCGGGCTACGAGCCCCGATCGTGGCATCATTTCTTTCTCCATACCGCCATCACTCTCTTCGCGCTGGCCGTCAAC
GCCCTGGGCGCCAGGCTGTTGCCGTACGTGACCAACGCGGCGCTGTATTGGGCGCTGGGCGGTCTGGTCTTGACT
TCCATCACCATCGTGTCCTGTACGGCGCCCGACTTTCAAGGCGGTGCCTTTGTTTATGGCGGTTTCATCAACGAC
GTCGGCTGGCCCGACGGACTGGCTTGGATGCTGGGGCTGCTTCAGGGCTCGTTTGCGCTGACGGGTGAGCGACGA
CGGAGAAAGATGGAGAGAGGGAGAGAGAAGGACACGTCTTGGAAGGCTGACAACTCGCTGTAGGCTACGACGCGA
CGGCTCACATGATCGAGGAGATGCCCGATCCTCAGCATCACGGCCCTCGCGTCATGCTCTACGCCGTCGGTATCG
GCGTCGTCACCGGCTTCTTCTTCGTCAGCTGCCTGCTCTTCTGCATCCATGACGTACAGCAGGTCGTCAACGCCC
CTTACGGCCCGCTGCTGCAGATATACATGGACGCCACCAAGAGCGTGGCCGGTAGCATCTGTCTCGTCGTCATCC
CCATCATCAGCGTCGTCTTTACCACAATCACCCTGCTCTCCGTCACCAGCCGCATGATCTACGCCTTTGCCCGCG
ACAGGGGCATGCCCTTTAGCAGCGTCTTCGCCCGGGTCCAGCCGGGGCTCGACGTGCCGTTGAACGCCCTGTTTG
GGGTGGCCGGCTGCTGTCTCGTCTTTGGCTGCATCTTGGTGGGCTCCTCGAGCGCCATGAATGCCATCACGGCGG
CGGCGGTGGTGGCCCTAGGCGTCACCTACGCCATCCCTCCGGCCATCAACGTCATCCGGGGCCGCCGCATGTTAC
CGGCGGACCGACCTTTTAAGCTGTCGGAGCCACTGGGATGGACGGTGAACCTGGTGAGCGCCGAGCCCCTTTTCG
AGACGACACCTCTCATCCAATGCTGACGGCGAGGGCGACCAAGGTGGGCATCGCCTGGACGGCATTGACGACGGT
GCTCTTCGTCTTCCCTCCGCGAGCACCGGCGACGCCCAGCAACATGAACTACTGCATCGTCGCCTTCGGCATCAT
CCTGCTGCTGGCCGGCCTGACGTGGGTGCTAGACGGACGACGACACTACCGCGGCCCTCAGATCGACGGCCTGGT
GACGGGCACGGGCTTCAGCTTGGTCGACGGCATCGCCGAGGGCGTCGAGAAGACCAAGGACGGGCAGCGGACGGC
GGGCGTCACGTCCGAGACGGTGTCCATCGAGGCCTCCGAGGGGACGGCTCAGGCTGATGGCACTACCAAGAAGGA
CGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail