Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00915
Gene name
Locationscaffold_01:3480233..3482040
Strand+
Gene length (bp)1807
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.1E-53 37 478
PF00324 AA_permease Amino acid permease 3.5E-19 50 483

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1424 0.135 0.0278 0.2721 0.1058 0.0025 0.3459 0.5699 0.4534 0.0161

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 69 91 22
3 124 146 22
4 161 183 22
5 190 212 22
6 268 290 22
7 316 338 22
8 370 392 22
9 399 421 22
10 436 458 22
11 470 489 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1529
Ophiocordyceps australis map64 (Brazil) OphauB2|2590
Ophiocordyceps australis map64 (Brazil) OphauB2|3855
Ophiocordyceps camponoti-floridani Ophcf2|00544
Ophiocordyceps camponoti-floridani Ophcf2|00915 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|503
Ophiocordyceps kimflemingae Ophio5|5532
Ophiocordyceps kimflemingae Ophio5|7648
Ophiocordyceps subramaniannii Hirsu2|4988
Ophiocordyceps subramaniannii Hirsu2|6556

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00915
MNGNSLKPHRTSCDDDAAALERLGHKQELKRNLSVMSMLGLAFAIVNTWTALAASLSVALPSGGCSAVVWGLLTS
GVCNMCLAASMAEFLSAYPTAGGQYHWAAIIAGRRAGRAVGFVTGWINVSGWVAISASGGLLGSTFILNAISLLH
PGYEPRSWHHFFLHTAITLFALAVNALGARLLPYVTNAALYWALGGLVLTSITIVSCTAPDFQGGAFVYGGFIND
VGWPDGLAWMLGLLQGSFALTGYDATAHMIEEMPDPQHHGPRVMLYAVGIGVVTGFFFVSCLLFCIHDVQQVVNA
PYGPLLQIYMDATKSVAGSICLVVIPIISVVFTTITLLSVTSRMIYAFARDRGMPFSSVFARVQPGLDVPLNALF
GVAGCCLVFGCILVGSSSAMNAITAAAVVALGVTYAIPPAINVIRGRRMLPADRPFKLSEPLGWTVNLVGIAWTA
LTTVLFVFPPRAPATPSNMNYCIVAFGIILLLAGLTWVLDGRRHYRGPQIDGLVTGTGFSLVDGIAEGVEKTKDG
QRTAGVTSETVSIEASEGTAQADGTTKKDV*
Coding >Ophcf2|00915
ATGAACGGAAACTCGCTCAAACCGCATAGGACGTCATGCGACGACGATGCCGCCGCGCTCGAACGCCTGGGCCAC
AAACAGGAGCTCAAGCGCAACTTGTCCGTGATGTCGATGCTCGGGCTGGCCTTTGCCATCGTCAACACCTGGACT
GCGCTCGCTGCCTCTCTCAGCGTGGCCTTGCCTTCGGGCGGTTGCAGCGCTGTCGTCTGGGGCTTGCTGACGTCG
GGTGTGTGTAACATGTGCCTCGCGGCGTCCATGGCAGAGTTCCTTTCTGCCTATCCTACAGCCGGGGGTCAGTAT
CACTGGGCTGCCATCATCGCCGGTCGTCGAGCTGGACGCGCTGTTGGCTTCGTTACCGGCTGGATCAACGTCTCG
GGCTGGGTGGCCATCAGCGCCTCGGGAGGCCTCCTGGGATCGACCTTTATTCTCAACGCCATCTCGCTGCTGCAT
CCGGGCTACGAGCCCCGATCGTGGCATCATTTCTTTCTCCATACCGCCATCACTCTCTTCGCGCTGGCCGTCAAC
GCCCTGGGCGCCAGGCTGTTGCCGTACGTGACCAACGCGGCGCTGTATTGGGCGCTGGGCGGTCTGGTCTTGACT
TCCATCACCATCGTGTCCTGTACGGCGCCCGACTTTCAAGGCGGTGCCTTTGTTTATGGCGGTTTCATCAACGAC
GTCGGCTGGCCCGACGGACTGGCTTGGATGCTGGGGCTGCTTCAGGGCTCGTTTGCGCTGACGGGCTACGACGCG
ACGGCTCACATGATCGAGGAGATGCCCGATCCTCAGCATCACGGCCCTCGCGTCATGCTCTACGCCGTCGGTATC
GGCGTCGTCACCGGCTTCTTCTTCGTCAGCTGCCTGCTCTTCTGCATCCATGACGTACAGCAGGTCGTCAACGCC
CCTTACGGCCCGCTGCTGCAGATATACATGGACGCCACCAAGAGCGTGGCCGGTAGCATCTGTCTCGTCGTCATC
CCCATCATCAGCGTCGTCTTTACCACAATCACCCTGCTCTCCGTCACCAGCCGCATGATCTACGCCTTTGCCCGC
GACAGGGGCATGCCCTTTAGCAGCGTCTTCGCCCGGGTCCAGCCGGGGCTCGACGTGCCGTTGAACGCCCTGTTT
GGGGTGGCCGGCTGCTGTCTCGTCTTTGGCTGCATCTTGGTGGGCTCCTCGAGCGCCATGAATGCCATCACGGCG
GCGGCGGTGGTGGCCCTAGGCGTCACCTACGCCATCCCTCCGGCCATCAACGTCATCCGGGGCCGCCGCATGTTA
CCGGCGGACCGACCTTTTAAGCTGTCGGAGCCACTGGGATGGACGGTGAACCTGGTGGGCATCGCCTGGACGGCA
TTGACGACGGTGCTCTTCGTCTTCCCTCCGCGAGCACCGGCGACGCCCAGCAACATGAACTACTGCATCGTCGCC
TTCGGCATCATCCTGCTGCTGGCCGGCCTGACGTGGGTGCTAGACGGACGACGACACTACCGCGGCCCTCAGATC
GACGGCCTGGTGACGGGCACGGGCTTCAGCTTGGTCGACGGCATCGCCGAGGGCGTCGAGAAGACCAAGGACGGG
CAGCGGACGGCGGGCGTCACGTCCGAGACGGTGTCCATCGAGGCCTCCGAGGGGACGGCTCAGGCTGATGGCACT
ACCAAGAAGGACGTCTAG
Transcript >Ophcf2|00915
ATGAACGGAAACTCGCTCAAACCGCATAGGACGTCATGCGACGACGATGCCGCCGCGCTCGAACGCCTGGGCCAC
AAACAGGAGCTCAAGCGCAACTTGTCCGTGATGTCGATGCTCGGGCTGGCCTTTGCCATCGTCAACACCTGGACT
GCGCTCGCTGCCTCTCTCAGCGTGGCCTTGCCTTCGGGCGGTTGCAGCGCTGTCGTCTGGGGCTTGCTGACGTCG
GGTGTGTGTAACATGTGCCTCGCGGCGTCCATGGCAGAGTTCCTTTCTGCCTATCCTACAGCCGGGGGTCAGTAT
CACTGGGCTGCCATCATCGCCGGTCGTCGAGCTGGACGCGCTGTTGGCTTCGTTACCGGCTGGATCAACGTCTCG
GGCTGGGTGGCCATCAGCGCCTCGGGAGGCCTCCTGGGATCGACCTTTATTCTCAACGCCATCTCGCTGCTGCAT
CCGGGCTACGAGCCCCGATCGTGGCATCATTTCTTTCTCCATACCGCCATCACTCTCTTCGCGCTGGCCGTCAAC
GCCCTGGGCGCCAGGCTGTTGCCGTACGTGACCAACGCGGCGCTGTATTGGGCGCTGGGCGGTCTGGTCTTGACT
TCCATCACCATCGTGTCCTGTACGGCGCCCGACTTTCAAGGCGGTGCCTTTGTTTATGGCGGTTTCATCAACGAC
GTCGGCTGGCCCGACGGACTGGCTTGGATGCTGGGGCTGCTTCAGGGCTCGTTTGCGCTGACGGGCTACGACGCG
ACGGCTCACATGATCGAGGAGATGCCCGATCCTCAGCATCACGGCCCTCGCGTCATGCTCTACGCCGTCGGTATC
GGCGTCGTCACCGGCTTCTTCTTCGTCAGCTGCCTGCTCTTCTGCATCCATGACGTACAGCAGGTCGTCAACGCC
CCTTACGGCCCGCTGCTGCAGATATACATGGACGCCACCAAGAGCGTGGCCGGTAGCATCTGTCTCGTCGTCATC
CCCATCATCAGCGTCGTCTTTACCACAATCACCCTGCTCTCCGTCACCAGCCGCATGATCTACGCCTTTGCCCGC
GACAGGGGCATGCCCTTTAGCAGCGTCTTCGCCCGGGTCCAGCCGGGGCTCGACGTGCCGTTGAACGCCCTGTTT
GGGGTGGCCGGCTGCTGTCTCGTCTTTGGCTGCATCTTGGTGGGCTCCTCGAGCGCCATGAATGCCATCACGGCG
GCGGCGGTGGTGGCCCTAGGCGTCACCTACGCCATCCCTCCGGCCATCAACGTCATCCGGGGCCGCCGCATGTTA
CCGGCGGACCGACCTTTTAAGCTGTCGGAGCCACTGGGATGGACGGTGAACCTGGTGGGCATCGCCTGGACGGCA
TTGACGACGGTGCTCTTCGTCTTCCCTCCGCGAGCACCGGCGACGCCCAGCAACATGAACTACTGCATCGTCGCC
TTCGGCATCATCCTGCTGCTGGCCGGCCTGACGTGGGTGCTAGACGGACGACGACACTACCGCGGCCCTCAGATC
GACGGCCTGGTGACGGGCACGGGCTTCAGCTTGGTCGACGGCATCGCCGAGGGCGTCGAGAAGACCAAGGACGGG
CAGCGGACGGCGGGCGTCACGTCCGAGACGGTGTCCATCGAGGCCTCCGAGGGGACGGCTCAGGCTGATGGCACT
ACCAAGAAGGACGTCTAG
Gene >Ophcf2|00915
ATGAACGGAAACTCGCTCAAACCGCATAGGACGTCATGCGACGACGATGCCGCCGCGCTCGAACGCCTGGGCCAC
AAACAGGAGCTCAAGCGCAACTTGTCCGTGATGTCGATGCTCGGGCTGGCCTTTGCCATCGTCAACACCTGGACT
GCGCTCGCTGCCTCTCTCAGCGTGGCCTTGCCTTCGGGCGGTTGCAGCGCTGTCGTCTGGGGCTTGCTGACGTCG
GGTGTGTGTAACATGTGCCTCGCGGCGTCCATGGCAGAGTTCCTTTCTGCCTATCCTACAGCCGGGGGTCAGTAT
CACTGGGCTGCCATCATCGCCGGTCGTCGAGCTGGACGCGCTGTTGGCTTCGTTACCGGCTGGATCAACGTCTCG
GGCTGGGTGGCCATCAGCGCCTCGGGAGGCCTCCTGGGATCGACCTTTATTCTCAACGCCATCTCGCTGCTGCAT
CCGGGCTACGAGCCCCGATCGTGGCATCATTTCTTTCTCCATACCGCCATCACTCTCTTCGCGCTGGCCGTCAAC
GCCCTGGGCGCCAGGCTGTTGCCGTACGTGACCAACGCGGCGCTGTATTGGGCGCTGGGCGGTCTGGTCTTGACT
TCCATCACCATCGTGTCCTGTACGGCGCCCGACTTTCAAGGCGGTGCCTTTGTTTATGGCGGTTTCATCAACGAC
GTCGGCTGGCCCGACGGACTGGCTTGGATGCTGGGGCTGCTTCAGGGCTCGTTTGCGCTGACGGGTGAGCGACGA
CGGAGAAAGATGGAGAGAGGGAGAGAGAAGGACACGTCTTGGAAGGCTGACAACTCGCTGTAGGCTACGACGCGA
CGGCTCACATGATCGAGGAGATGCCCGATCCTCAGCATCACGGCCCTCGCGTCATGCTCTACGCCGTCGGTATCG
GCGTCGTCACCGGCTTCTTCTTCGTCAGCTGCCTGCTCTTCTGCATCCATGACGTACAGCAGGTCGTCAACGCCC
CTTACGGCCCGCTGCTGCAGATATACATGGACGCCACCAAGAGCGTGGCCGGTAGCATCTGTCTCGTCGTCATCC
CCATCATCAGCGTCGTCTTTACCACAATCACCCTGCTCTCCGTCACCAGCCGCATGATCTACGCCTTTGCCCGCG
ACAGGGGCATGCCCTTTAGCAGCGTCTTCGCCCGGGTCCAGCCGGGGCTCGACGTGCCGTTGAACGCCCTGTTTG
GGGTGGCCGGCTGCTGTCTCGTCTTTGGCTGCATCTTGGTGGGCTCCTCGAGCGCCATGAATGCCATCACGGCGG
CGGCGGTGGTGGCCCTAGGCGTCACCTACGCCATCCCTCCGGCCATCAACGTCATCCGGGGCCGCCGCATGTTAC
CGGCGGACCGACCTTTTAAGCTGTCGGAGCCACTGGGATGGACGGTGAACCTGGTGAGCGCCGAGCCCCTTTTCG
AGACGACACCTCTCATCCAATGCTGACGGCGAGGGCGACCAAGGTGGGCATCGCCTGGACGGCATTGACGACGGT
GCTCTTCGTCTTCCCTCCGCGAGCACCGGCGACGCCCAGCAACATGAACTACTGCATCGTCGCCTTCGGCATCAT
CCTGCTGCTGGCCGGCCTGACGTGGGTGCTAGACGGACGACGACACTACCGCGGCCCTCAGATCGACGGCCTGGT
GACGGGCACGGGCTTCAGCTTGGTCGACGGCATCGCCGAGGGCGTCGAGAAGACCAAGGACGGGCAGCGGACGGC
GGGCGTCACGTCCGAGACGGTGTCCATCGAGGCCTCCGAGGGGACGGCTCAGGCTGATGGCACTACCAAGAAGGA
CGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail