Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00913
Gene name
Locationscaffold_01:3476204..3477824
Strand-
Gene length (bp)1620
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-23 2 396
PF00083 Sugar_tr Sugar (and other) transporter 1.4E-07 27 185

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 53 72 19
3 82 104 22
4 111 133 22
5 148 170 22
6 191 210 19
7 215 237 22
8 250 272 22
9 287 309 22
10 316 338 22
11 342 364 22
12 385 407 22
13 459 481 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 2.03 0.39 3.66
Alive In ants, during behavior modification 4.17 1.16 7.18
Dead In ants, recently dead 4.16 1.16 7.17

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.029648 yes
Alive Dead 0.997626 no
Dead Fungus 0.030758 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00913
MSGMAIIQDTIARSLDAPPSLSPWFTTSYLMALSASVPIVGRLAGAGAAMPRILLLPAAAIFCAGALLAASASSA
AVFIGGRVLAGVGGGAFLALAFVFVLALVPEPRRGIGLGVINAAITVGVSLGAVVYGGLLSAVGWRERQRPLFWM
QAPVAFVAALAVFLCTPASIQSDQKHRESPSSLSRRLVRIDYLGAVLLCLTVVLFLYGLASTVQPLILGLSIVSL
AAFIACEYLVAVDPVLPLTLLSSRGVLLSCISQLGLMAARWSLLFFAPIFILAVHGAPRSAAGSVLVPTNLGFAV
GGIVVGSLHIRRTGSFWLSCLIALAFFSASILGLAIVASPRAALTPLIALVFINGFATGAALNYTMAHLLHLCHP
DTEYVAASLLATFRGFGGSFGTSIGGGMFYRFLRRSLARGFLALDGGQHLSPAHSTLIPRLLGMPELVLHGGLSS
EEQKVALNGYAGAIGFVWMAAAILMLMVMAAQAATGWTAPKPLRSADTVAHRRDE*
Coding >Ophcf2|00913
ATGTCCGGCATGGCCATCATCCAAGACACCATCGCCCGCTCGTTAGACGCCCCCCCATCTCTCTCCCCCTGGTTC
ACAACATCCTACCTGATGGCCCTCTCCGCTTCGGTCCCGATCGTCGGTCGCCTCGCCGGAGCCGGAGCCGCCATG
CCACGGATCCTCCTGCTGCCGGCCGCGGCCATCTTCTGCGCCGGCGCACTTCTCGCGGCATCAGCCTCGTCAGCG
GCCGTCTTCATCGGTGGACGCGTTCTCGCCGGTGTCGGAGGAGGTGCCTTCTTGGCCCTCGCCTTTGTCTTCGTG
CTTGCGCTGGTGCCGGAGCCGCGGAGGGGCATCGGGCTGGGCGTCATAAACGCGGCCATCACTGTCGGTGTCTCG
CTGGGCGCTGTCGTCTATGGAGGTTTACTTTCTGCCGTGGGATGGCGAGAGAGACAGAGGCCCCTATTCTGGATG
CAGGCTCCCGTCGCCTTTGTCGCCGCTCTAGCCGTCTTTCTCTGCACGCCGGCGTCAATCCAGTCTGATCAGAAG
CACCGAGAGTCGCCGTCGTCACTTTCACGGCGGCTGGTCCGGATCGACTATCTCGGAGCTGTCCTCCTTTGCCTC
ACCGTAGTCCTCTTCCTCTACGGCCTCGCCAGCACCGTCCAGCCTCTCATCCTCGGCCTATCCATCGTGTCTCTC
GCGGCCTTTATCGCGTGCGAGTACCTCGTCGCCGTCGATCCCGTCTTACCCCTGACCCTCCTCTCCTCACGCGGA
GTCCTCCTCTCGTGTATCTCCCAGCTTGGTCTCATGGCTGCCCGCTGGAGTCTCCTCTTCTTCGCCCCCATCTTC
ATCCTTGCCGTTCACGGGGCCCCCCGTTCCGCCGCGGGCTCCGTTCTGGTGCCGACCAACCTCGGCTTCGCTGTA
GGCGGCATCGTCGTCGGCTCGCTGCACATCCGTCGTACCGGCTCCTTCTGGCTATCATGTCTCATCGCCTTGGCC
TTCTTTTCCGCCTCTATTCTCGGTCTCGCCATCGTAGCATCCCCGCGAGCCGCTCTGACGCCCCTTATAGCTCTC
GTCTTCATCAACGGCTTCGCGACGGGAGCTGCCCTCAACTACACCATGGCCCATCTGCTCCATCTCTGCCACCCC
GACACCGAGTATGTCGCCGCCAGTCTCCTCGCCACGTTCCGCGGCTTCGGCGGCAGCTTCGGAACCTCCATCGGC
GGCGGTATGTTCTATCGCTTCCTGCGACGCAGCCTCGCCCGCGGATTCTTGGCCCTCGACGGCGGCCAGCACCTC
AGCCCGGCTCATAGTACGCTGATACCACGCCTCCTTGGCATGCCGGAGTTGGTTTTGCACGGCGGCCTTTCCAGC
GAAGAGCAGAAAGTCGCTTTGAACGGCTATGCGGGTGCCATCGGCTTCGTCTGGATGGCCGCCGCCATTCTGATG
CTGATGGTCATGGCGGCACAGGCAGCGACGGGATGGACAGCGCCTAAGCCATTAAGATCAGCAGATACGGTAGCC
CACAGACGAGATGAATGA
Transcript >Ophcf2|00913
ATGTCCGGCATGGCCATCATCCAAGACACCATCGCCCGCTCGTTAGACGCCCCCCCATCTCTCTCCCCCTGGTTC
ACAACATCCTACCTGATGGCCCTCTCCGCTTCGGTCCCGATCGTCGGTCGCCTCGCCGGAGCCGGAGCCGCCATG
CCACGGATCCTCCTGCTGCCGGCCGCGGCCATCTTCTGCGCCGGCGCACTTCTCGCGGCATCAGCCTCGTCAGCG
GCCGTCTTCATCGGTGGACGCGTTCTCGCCGGTGTCGGAGGAGGTGCCTTCTTGGCCCTCGCCTTTGTCTTCGTG
CTTGCGCTGGTGCCGGAGCCGCGGAGGGGCATCGGGCTGGGCGTCATAAACGCGGCCATCACTGTCGGTGTCTCG
CTGGGCGCTGTCGTCTATGGAGGTTTACTTTCTGCCGTGGGATGGCGAGAGAGACAGAGGCCCCTATTCTGGATG
CAGGCTCCCGTCGCCTTTGTCGCCGCTCTAGCCGTCTTTCTCTGCACGCCGGCGTCAATCCAGTCTGATCAGAAG
CACCGAGAGTCGCCGTCGTCACTTTCACGGCGGCTGGTCCGGATCGACTATCTCGGAGCTGTCCTCCTTTGCCTC
ACCGTAGTCCTCTTCCTCTACGGCCTCGCCAGCACCGTCCAGCCTCTCATCCTCGGCCTATCCATCGTGTCTCTC
GCGGCCTTTATCGCGTGCGAGTACCTCGTCGCCGTCGATCCCGTCTTACCCCTGACCCTCCTCTCCTCACGCGGA
GTCCTCCTCTCGTGTATCTCCCAGCTTGGTCTCATGGCTGCCCGCTGGAGTCTCCTCTTCTTCGCCCCCATCTTC
ATCCTTGCCGTTCACGGGGCCCCCCGTTCCGCCGCGGGCTCCGTTCTGGTGCCGACCAACCTCGGCTTCGCTGTA
GGCGGCATCGTCGTCGGCTCGCTGCACATCCGTCGTACCGGCTCCTTCTGGCTATCATGTCTCATCGCCTTGGCC
TTCTTTTCCGCCTCTATTCTCGGTCTCGCCATCGTAGCATCCCCGCGAGCCGCTCTGACGCCCCTTATAGCTCTC
GTCTTCATCAACGGCTTCGCGACGGGAGCTGCCCTCAACTACACCATGGCCCATCTGCTCCATCTCTGCCACCCC
GACACCGAGTATGTCGCCGCCAGTCTCCTCGCCACGTTCCGCGGCTTCGGCGGCAGCTTCGGAACCTCCATCGGC
GGCGGTATGTTCTATCGCTTCCTGCGACGCAGCCTCGCCCGCGGATTCTTGGCCCTCGACGGCGGCCAGCACCTC
AGCCCGGCTCATAGTACGCTGATACCACGCCTCCTTGGCATGCCGGAGTTGGTTTTGCACGGCGGCCTTTCCAGC
GAAGAGCAGAAAGTCGCTTTGAACGGCTATGCGGGTGCCATCGGCTTCGTCTGGATGGCCGCCGCCATTCTGATG
CTGATGGTCATGGCGGCACAGGCAGCGACGGGATGGACAGCGCCTAAGCCATTAAGATCAGCAGATACGGTAGCC
CACAGACGAGATGAATGA
Gene >Ophcf2|00913
ATGTCCGGCATGGCCATCATCCAAGACACCATCGCCCGCTCGTTAGACGCCCCCCCATCTCTCTCCCCCTGGTTC
ACAACATCCTACCTGATGGCCCTCTCCGCTTCGGTCCCGATCGTCGGTCGCCTCGCCGGAGCCGGAGCCGCCATG
CCACGGATCCTCCTGCTGCCGGCCGCGGCCATCTTCTGCGCCGGCGCACTTCTCGCGGCATCAGCCTCGTCAGCG
GCCGTCTTCATCGGTGGACGCGTTCTCGCCGGTGTCGGAGGAGGTGCCTTCTTGGCCCTCGCCTTTGTCTTCGTG
CTTGCGCTGGTGCCGGAGCCGCGGAGGGGCATCGGGCTGGGCGTCATAAACGCGGCCATCACTGTCGGTGTCTCG
CTGGGCGCTGTCGTCTATGGAGGTTTACTTTCTGCCGTGGGATGGGTGAGTCAGGAGCCATTGTGTCAAGTATAC
GAGTACTCTGTCTTTGATCTTACCAGCGAGAGAGACAGAGGCCCCTATTCTGGATGCAGGCTCCCGTCGCCTTTG
TCGCCGCTCTAGCCGTCTTTCTCTGCACGCCGGCGTCAATCCAGTCTGATCAGAAGCACCGAGAGTCGCCGTCGT
CACTTTCACGGCGGCTGGTCCGGATCGACTATCTCGGAGCTGTCCTCCTTGTAAGTCTCGTCTCGTCTTCTCTGC
TGTCCCGGACTCACCATCCAGTGCCTCACCGTAGTCCTCTTCCTCTACGGCCTCGCCAGCACCGTCCAGCCTCTC
ATCCTCGGCCTATCCATCGTGTCTCTCGCGGCCTTTATCGCGTGCGAGTACCTCGTCGCCGTCGATCCCGTCTTA
CCCCTGACCCTCCTCTCCTCACGCGGAGTCCTCCTCTCGTGTATCTCCCAGCTTGGTCTCATGGCTGCCCGCTGG
AGTCTCCTCTTCTTCGCCCCCATCTTCATCCTTGCCGTTCACGGGGCCCCCCGTTCCGCCGCGGGCTCCGTTCTG
GTGCCGACCAACCTCGGCTTCGCTGTAGGCGGCATCGTCGTCGGCTCGCTGCACATCCGTCGTACCGGCTCCTTC
TGGCTATCATGTCTCATCGCCTTGGCCTTCTTTTCCGCCTCTATTCTCGGTCTCGCCATCGTAGCATCCCCGCGA
GCCGCTCTGACGCCCCTTATAGCTCTCGTCTTCATCAACGGCTTCGCGACGGGAGCTGCCCTCAACTACACCATG
GCCCATCTGCTCCATCTCTGCCACCCCGACACCGAGTATGTCGCCGCCAGTCTCCTCGCCACGTTCCGCGGCTTC
GGCGGCAGCTTCGGAACCTCCATCGGCGGCGGTATGTTCTATCGCTTCCTGCGACGCAGCCTCGCCCGCGGATTC
TTGGCCCTCGACGGCGGCCAGCACCTCAGCCCGGCTCATAGTACGCTGATACCACGCCTCCTTGGCATGCCGGAG
TTGGTTTTGCACGGCGGCCTTTCCAGCGAAGAGCAGAAAGTCGCTTTGAACGGCTATGCGGGTGCCATCGGCTTC
GTCTGGATGGCCGCCGCCATTCTGATGCTGATGGTCATGGCGGCACAGGCAGCGACGGGATGGACAGCGCCTAAG
CCATTAAGATCAGCAGATACGGTAGCCCACAGACGAGATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail