Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00911
Gene name
Locationscaffold_01:3472939..3474488
Strand-
Gene length (bp)1549
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10516 SHNi-TPR SHNi-TPR 2.5E-11 249 286

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5662 0.8461 0.0878 0.0568 0.028 0.0034 0.0148 0.0387 0.046 0.0145

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1508
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7944
Ophiocordyceps australis map64 (Brazil) OphauB2|7581
Ophiocordyceps camponoti-floridani Ophcf2|00911 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4088
Ophiocordyceps kimflemingae Ophio5|5536
Ophiocordyceps subramaniannii Hirsu2|11163

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00911
MTEAIPDQTRRDPEAEPAMTTDGDDIKSKRVTLADLSAKGTALYAQKSYEAAADIFSTASTLQASINGETAPENA
EILFHYGRSLFRVGQSKSDVLGGPATAAAAAVDAAVGSDSKKPKQAAGDDAKEPADDAKPAESETAKKEEPSVKD
NATIKDAVPDAKKPLFQFTGDDNFDQDDDDEDDDQEVEDEANEAEDDELAMAFEILDLARVCYLKQLEQLEKEHP
PGKGKDAAPAEDPPSVRHVKERLADTHDCLAEISLENERYPDAIEDGRVSLKYKMDLYPEESEVIAEAHYKLSLA
LEFASVTTPAPEEDESKSTSKDQNNTANKPAAMDTALRNESIHEMELAIKSFRLKMQTEEVELATMASPEDNDAA
RKAIAEMKDIVADMETRLVDLRKGPVDADALIASAMSSKQPSKPSDEARQKATDLTALVRKKTRGADEGKRKAEE
EPAGAENGSTSPKKARIEEGDAAAAVAS*
Coding >Ophcf2|00911
ATGACCGAAGCCATCCCTGACCAAACACGTCGCGATCCCGAAGCCGAGCCAGCCATGACGACGGACGGCGACGAC
ATCAAGTCCAAGCGCGTGACGCTGGCCGACCTCAGCGCAAAGGGCACCGCGCTGTACGCGCAGAAGAGCTACGAG
GCCGCGGCCGACATCTTCTCGACTGCTAGCACCCTTCAGGCCAGCATCAACGGCGAGACGGCGCCCGAGAACGCC
GAGATCCTCTTCCACTACGGCCGCAGCCTCTTCAGGGTCGGCCAGAGTAAGAGCGACGTTCTCGGCGGTCCTGCT
ACTGCTGCTGCCGCTGCCGTCGATGCTGCTGTTGGTTCCGATTCCAAGAAGCCGAAGCAGGCTGCTGGCGATGAT
GCGAAGGAACCCGCCGACGATGCGAAGCCGGCTGAATCAGAGACCGCCAAAAAGGAAGAACCTTCCGTCAAGGAC
AATGCCACTATCAAAGACGCCGTCCCTGATGCCAAGAAGCCTCTTTTCCAGTTCACCGGCGACGACAACTTTGAC
CAGGACGACGATGACGAAGATGACGATCAAGAAGTCGAAGACGAGGCCAACGAGGCCGAAGACGACGAGCTGGCC
ATGGCATTCGAGATCCTCGATCTCGCCCGCGTCTGCTACCTGAAGCAGCTCGAACAGCTCGAAAAGGAACATCCG
CCAGGCAAAGGCAAGGACGCGGCCCCAGCCGAAGACCCCCCTTCAGTCCGACACGTCAAGGAGCGTCTGGCCGAC
ACGCACGACTGCCTCGCCGAGATTTCCCTTGAGAACGAACGATACCCCGACGCCATCGAAGACGGCCGCGTCTCC
CTCAAATACAAAATGGACCTCTACCCCGAAGAGTCAGAAGTCATCGCCGAAGCCCACTACAAGCTCTCCCTCGCC
CTCGAATTCGCCTCCGTCACCACGCCAGCACCCGAGGAAGACGAATCAAAATCAACAAGCAAAGATCAAAACAAC
ACGGCTAATAAACCGGCCGCAATGGACACAGCCCTCCGCAACGAATCCATCCACGAAATGGAACTCGCCATCAAG
AGCTTCCGCCTCAAGATGCAAACCGAAGAGGTCGAGCTCGCAACCATGGCCTCGCCAGAAGACAACGACGCGGCC
CGTAAAGCCATCGCCGAAATGAAGGACATCGTCGCCGACATGGAAACGCGCCTCGTCGACCTCCGCAAGGGTCCA
GTCGACGCGGACGCCCTCATCGCCTCCGCAATGTCAAGCAAGCAGCCGTCCAAGCCGTCAGACGAGGCGCGCCAG
AAGGCAACCGACCTCACCGCCCTCGTCAGGAAGAAGACCCGCGGCGCCGACGAGGGGAAGCGAAAGGCCGAGGAG
GAGCCCGCCGGGGCTGAGAATGGCAGCACTTCGCCCAAGAAGGCCAGGATCGAGGAGGGTGATGCTGCTGCTGCT
GTTGCTTCCTAG
Transcript >Ophcf2|00911
ATGACCGAAGCCATCCCTGACCAAACACGTCGCGATCCCGAAGCCGAGCCAGCCATGACGACGGACGGCGACGAC
ATCAAGTCCAAGCGCGTGACGCTGGCCGACCTCAGCGCAAAGGGCACCGCGCTGTACGCGCAGAAGAGCTACGAG
GCCGCGGCCGACATCTTCTCGACTGCTAGCACCCTTCAGGCCAGCATCAACGGCGAGACGGCGCCCGAGAACGCC
GAGATCCTCTTCCACTACGGCCGCAGCCTCTTCAGGGTCGGCCAGAGTAAGAGCGACGTTCTCGGCGGTCCTGCT
ACTGCTGCTGCCGCTGCCGTCGATGCTGCTGTTGGTTCCGATTCCAAGAAGCCGAAGCAGGCTGCTGGCGATGAT
GCGAAGGAACCCGCCGACGATGCGAAGCCGGCTGAATCAGAGACCGCCAAAAAGGAAGAACCTTCCGTCAAGGAC
AATGCCACTATCAAAGACGCCGTCCCTGATGCCAAGAAGCCTCTTTTCCAGTTCACCGGCGACGACAACTTTGAC
CAGGACGACGATGACGAAGATGACGATCAAGAAGTCGAAGACGAGGCCAACGAGGCCGAAGACGACGAGCTGGCC
ATGGCATTCGAGATCCTCGATCTCGCCCGCGTCTGCTACCTGAAGCAGCTCGAACAGCTCGAAAAGGAACATCCG
CCAGGCAAAGGCAAGGACGCGGCCCCAGCCGAAGACCCCCCTTCAGTCCGACACGTCAAGGAGCGTCTGGCCGAC
ACGCACGACTGCCTCGCCGAGATTTCCCTTGAGAACGAACGATACCCCGACGCCATCGAAGACGGCCGCGTCTCC
CTCAAATACAAAATGGACCTCTACCCCGAAGAGTCAGAAGTCATCGCCGAAGCCCACTACAAGCTCTCCCTCGCC
CTCGAATTCGCCTCCGTCACCACGCCAGCACCCGAGGAAGACGAATCAAAATCAACAAGCAAAGATCAAAACAAC
ACGGCTAATAAACCGGCCGCAATGGACACAGCCCTCCGCAACGAATCCATCCACGAAATGGAACTCGCCATCAAG
AGCTTCCGCCTCAAGATGCAAACCGAAGAGGTCGAGCTCGCAACCATGGCCTCGCCAGAAGACAACGACGCGGCC
CGTAAAGCCATCGCCGAAATGAAGGACATCGTCGCCGACATGGAAACGCGCCTCGTCGACCTCCGCAAGGGTCCA
GTCGACGCGGACGCCCTCATCGCCTCCGCAATGTCAAGCAAGCAGCCGTCCAAGCCGTCAGACGAGGCGCGCCAG
AAGGCAACCGACCTCACCGCCCTCGTCAGGAAGAAGACCCGCGGCGCCGACGAGGGGAAGCGAAAGGCCGAGGAG
GAGCCCGCCGGGGCTGAGAATGGCAGCACTTCGCCCAAGAAGGCCAGGATCGAGGAGGGTGATGCTGCTGCTGCT
GTTGCTTCCTAG
Gene >Ophcf2|00911
ATGACCGAAGCCATCCCTGACCAAACACGTCGCGATCCCGAAGCCGAGCCAGCCATGACGACGGACGGCGACGAC
ATCAAGTCCAAGCGCGTGACGCTGGCCGACCTCAGCGCAAAGGGCACCGCGCTGTACGCGCAGAAGAGCTACGAG
GCCGCGGCCGACATCTTCTCGACTGCTAGCACCCTTCAGGCCAGCATCAACGGCGAGACGGCGCCCGAGAACGCC
GAGATCCTCTTCCACTACGGCCGCAGCCTCTTCAGGGTCGGCCAGAGTAAGAGCGACGTTCTCGGCGGTCCTGCT
ACTGCTGCTGCCGCTGCCGTCGATGCTGCTGTTGGTTCCGATTCCAAGAAGCCGAAGCAGGCTGCTGGCGATGAT
GCGAAGGAACCCGCCGACGATGCGAAGCCGGCTGAATCAGAGACCGCCAAAAAGGAAGAACCTTCCGTCAAGGAC
AATGCCACTATCAAAGACGCCGTCCCTGATGCCAAGAAGCCTCTTTTCCAGTTCACCGGCGACGACAACTTTGAC
CAGGACGACGATGACGAAGATGACGATCAAGTCAGTAAACTTTCTTCATCACCCCTGCTCTCCTAACGTCCACCA
GGAAGTCGAAGACGAGGCCAACGAGGCCGAAGACGACGAGCTGGCCATGGCATTCGAGATCCTCGATCTCGCCCG
CGTCTGCTACCTGAAGCAGCTCGAACAGCTCGAAAAGGAACATCCGCCAGGCAAAGGCAAGGACGCGGCCCCAGC
CGAAGACCCCCCTTCAGTCCGACACGTCAAGGAGCGTCTGGCCGACACGCACGACTGCCTCGCCGAGATTTCCCT
TGAGAACGAACGGTGAGCCATCCCCCCTTCCCTCAACCTCTTCATCCTGAAGCTCTAACAAGCGTCAAAAACTTC
AAGATACCCCGACGCCATCGAAGACGGCCGCGTCTCCCTCAAATACAAAATGGACCTCTACCCCGAAGAGTCAGA
AGTCATCGCCGAAGCCCACTACAAGCTCTCCCTCGCCCTCGAATTCGCCTCCGTCACCACGCCAGCACCCGAGGA
AGACGAATCAAAATCAACAAGCAAAGATCAAAACAACACGGCTAATAAACCGGCCGCAATGGACACAGCCCTCCG
CAACGAATCCATCCACGAAATGGAACTCGCCATCAAGAGCTTCCGCCTCAAGATGCAAACCGAAGAGGTCGAGCT
CGCAACCATGGCCTCGCCAGAAGACAACGACGCGGCCCGTAAAGCCATCGCCGAAATGAAGGACATCGTCGCCGA
CATGGAAACGCGCCTCGTCGACCTCCGCAAGGGTCCAGTCGACGCGGACGCCCTCATCGCCTCCGCAATGTCAAG
CAAGCAGCCGTCCAAGCCGTCAGACGAGGCGCGCCAGAAGGCAACCGACCTCACCGCCCTCGTCAGGAAGAAGAC
CCGCGGCGCCGACGAGGGGAAGCGAAAGGCCGAGGAGGAGCCCGCCGGGGCTGAGAATGGCAGCACTTCGCCCAA
GAAGGCCAGGATCGAGGAGGGTGATGCTGCTGCTGCTGTTGCTTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail