Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00904
Gene name
Locationscaffold_01:3453229..3454480
Strand-
Gene length (bp)1251
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 2.1E-20 54 159
PF13242 Hydrolase_like HAD-hyrolase-like 9.3E-13 287 375

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.662 0.3713 0.1161 0.0773 0.4685 0.0218 0.2985 0.2369 0.253 0.1533

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2861
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1975
Ophiocordyceps australis map64 (Brazil) OphauB2|106
Ophiocordyceps camponoti-floridani Ophcf2|00904 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5147
Ophiocordyceps kimflemingae Ophio5|727
Ophiocordyceps subramaniannii Hirsu2|4727

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00904
MTLRHDTEPPVSPDSAPSSPWQVSSSSSSARTESSVATPSSATPPLAVADSYVFAFDIDGVLVRGGNAIPEAIEA
MKVLNGENEYGTHVPHIFVTNGGGKTEAERCADLSAQLKTDIKPGQFICGHTPMREMADRYRTVLIVGGEGEKCR
TVAEGYGFTDVVTPGDIIKHDSATTPFRKLTAEEHANSRERDFSDVVIDAVFVFADSRDWAGDIQIMLDLAMSRG
GRLGTRSDTFDQGPPFYFSHNDVVWSAAHEHVRLGMGALRRMFEVTFRDLTAGQGRLRTHAFGKPQVSTFEFASR
LMSQWRCEEHGLTSDPPQTIYFVGDTPESDIRGTNAVDEKSDNEWYSILVKTGVYQDGTEPAFKPRAIVDNVLDA
VKLGIQREMRKKVSTSLEKKMGSGPAKIREVDVPLPGGPAA*
Coding >Ophcf2|00904
ATGACCCTTCGTCACGACACCGAGCCTCCCGTCTCGCCAGATTCGGCCCCGAGCTCGCCATGGCAGGTATCGTCG
TCGTCGTCCAGCGCACGGACAGAAAGCAGCGTGGCCACGCCCAGCTCGGCCACGCCCCCACTGGCGGTAGCAGAC
TCGTACGTCTTCGCCTTCGACATCGACGGCGTCCTGGTCCGCGGCGGCAACGCCATCCCTGAAGCCATCGAGGCC
ATGAAGGTGCTCAACGGCGAGAACGAGTACGGCACCCACGTCCCGCACATCTTCGTCACCAACGGCGGCGGCAAG
ACTGAGGCCGAACGGTGCGCCGATCTGTCGGCTCAGCTAAAGACGGACATTAAGCCCGGTCAGTTCATCTGCGGA
CACACGCCCATGCGAGAGATGGCGGATCGCTACCGCACCGTCCTCATCGTAGGCGGCGAGGGCGAGAAGTGCCGG
ACCGTGGCCGAGGGTTATGGCTTTACCGACGTCGTCACCCCCGGAGACATCATCAAGCACGACTCGGCCACAACG
CCCTTCCGCAAGTTGACGGCTGAGGAGCACGCCAACTCTCGCGAGAGGGATTTCTCCGACGTCGTCATAGATGCC
GTCTTTGTCTTCGCCGACTCGCGCGACTGGGCTGGCGATATCCAGATCATGCTCGACCTCGCCATGTCTCGCGGA
GGGAGACTCGGAACCCGTAGCGATACCTTTGACCAAGGTCCTCCCTTTTACTTCTCTCACAATGACGTCGTCTGG
TCCGCCGCCCACGAGCACGTCCGCCTCGGCATGGGAGCGTTGAGACGCATGTTCGAGGTCACCTTCCGAGATCTG
ACTGCCGGCCAAGGTCGACTGCGTACACACGCCTTCGGGAAGCCTCAGGTCTCGACCTTTGAGTTCGCCTCGCGT
CTGATGAGCCAGTGGCGCTGCGAGGAGCATGGCCTGACGAGCGACCCGCCTCAGACCATCTATTTCGTCGGGGAC
ACGCCCGAGAGCGACATCCGCGGCACCAACGCCGTTGACGAAAAGTCCGACAACGAATGGTACAGCATCCTGGTC
AAGACGGGCGTCTACCAGGACGGCACCGAGCCCGCCTTCAAGCCAAGGGCCATCGTCGACAACGTCCTCGATGCC
GTCAAGCTCGGCATTCAGCGCGAGATGCGCAAGAAGGTGTCTACCTCGCTGGAGAAGAAGATGGGCAGCGGCCCG
GCCAAGATTCGGGAGGTTGATGTGCCTCTACCCGGCGGTCCAGCTGCGTGA
Transcript >Ophcf2|00904
ATGACCCTTCGTCACGACACCGAGCCTCCCGTCTCGCCAGATTCGGCCCCGAGCTCGCCATGGCAGGTATCGTCG
TCGTCGTCCAGCGCACGGACAGAAAGCAGCGTGGCCACGCCCAGCTCGGCCACGCCCCCACTGGCGGTAGCAGAC
TCGTACGTCTTCGCCTTCGACATCGACGGCGTCCTGGTCCGCGGCGGCAACGCCATCCCTGAAGCCATCGAGGCC
ATGAAGGTGCTCAACGGCGAGAACGAGTACGGCACCCACGTCCCGCACATCTTCGTCACCAACGGCGGCGGCAAG
ACTGAGGCCGAACGGTGCGCCGATCTGTCGGCTCAGCTAAAGACGGACATTAAGCCCGGTCAGTTCATCTGCGGA
CACACGCCCATGCGAGAGATGGCGGATCGCTACCGCACCGTCCTCATCGTAGGCGGCGAGGGCGAGAAGTGCCGG
ACCGTGGCCGAGGGTTATGGCTTTACCGACGTCGTCACCCCCGGAGACATCATCAAGCACGACTCGGCCACAACG
CCCTTCCGCAAGTTGACGGCTGAGGAGCACGCCAACTCTCGCGAGAGGGATTTCTCCGACGTCGTCATAGATGCC
GTCTTTGTCTTCGCCGACTCGCGCGACTGGGCTGGCGATATCCAGATCATGCTCGACCTCGCCATGTCTCGCGGA
GGGAGACTCGGAACCCGTAGCGATACCTTTGACCAAGGTCCTCCCTTTTACTTCTCTCACAATGACGTCGTCTGG
TCCGCCGCCCACGAGCACGTCCGCCTCGGCATGGGAGCGTTGAGACGCATGTTCGAGGTCACCTTCCGAGATCTG
ACTGCCGGCCAAGGTCGACTGCGTACACACGCCTTCGGGAAGCCTCAGGTCTCGACCTTTGAGTTCGCCTCGCGT
CTGATGAGCCAGTGGCGCTGCGAGGAGCATGGCCTGACGAGCGACCCGCCTCAGACCATCTATTTCGTCGGGGAC
ACGCCCGAGAGCGACATCCGCGGCACCAACGCCGTTGACGAAAAGTCCGACAACGAATGGTACAGCATCCTGGTC
AAGACGGGCGTCTACCAGGACGGCACCGAGCCCGCCTTCAAGCCAAGGGCCATCGTCGACAACGTCCTCGATGCC
GTCAAGCTCGGCATTCAGCGCGAGATGCGCAAGAAGGTGTCTACCTCGCTGGAGAAGAAGATGGGCAGCGGCCCG
GCCAAGATTCGGGAGGTTGATGTGCCTCTACCCGGCGGTCCAGCTGCGTGA
Gene >Ophcf2|00904
ATGACCCTTCGTCACGACACCGAGCCTCCCGTCTCGCCAGATTCGGCCCCGAGCTCGCCATGGCAGGTATCGTCG
TCGTCGTCCAGCGCACGGACAGAAAGCAGCGTGGCCACGCCCAGCTCGGCCACGCCCCCACTGGCGGTAGCAGAC
TCGTACGTCTTCGCCTTCGACATCGACGGCGTCCTGGTCCGCGGCGGCAACGCCATCCCTGAAGCCATCGAGGCC
ATGAAGGTGCTCAACGGCGAGAACGAGTACGGCACCCACGTCCCGCACATCTTCGTCACCAACGGCGGCGGCAAG
ACTGAGGCCGAACGGTGCGCCGATCTGTCGGCTCAGCTAAAGACGGACATTAAGCCCGGTCAGTTCATCTGCGGA
CACACGCCCATGCGAGAGATGGCGGATCGCTACCGCACCGTCCTCATCGTAGGCGGCGAGGGCGAGAAGTGCCGG
ACCGTGGCCGAGGGTTATGGCTTTACCGACGTCGTCACCCCCGGAGACATCATCAAGCACGACTCGGCCACAACG
CCCTTCCGCAAGTTGACGGCTGAGGAGCACGCCAACTCTCGCGAGAGGGATTTCTCCGACGTCGTCATAGATGCC
GTCTTTGTCTTCGCCGACTCGCGCGACTGGGCTGGCGATATCCAGATCATGCTCGACCTCGCCATGTCTCGCGGA
GGGAGACTCGGAACCCGTAGCGATACCTTTGACCAAGGTCCTCCCTTTTACTTCTCTCACAATGACGTCGTCTGG
TCCGCCGCCCACGAGCACGTCCGCCTCGGCATGGGAGCGTTGAGACGCATGTTCGAGGTCACCTTCCGAGATCTG
ACTGCCGGCCAAGGTCGACTGCGTACACACGCCTTCGGGAAGCCTCAGGTCTCGACCTTTGAGTTCGCCTCGCGT
CTGATGAGCCAGTGGCGCTGCGAGGAGCATGGCCTGACGAGCGACCCGCCTCAGACCATCTATTTCGTCGGGGAC
ACGCCCGAGAGCGACATCCGCGGCACCAACGCCGTTGACGAAAAGTCCGACAACGAATGGTACAGCATCCTGGTC
AAGACGGGCGTCTACCAGGACGGCACCGAGCCCGCCTTCAAGCCAAGGGCCATCGTCGACAACGTCCTCGATGCC
GTCAAGCTCGGCATTCAGCGCGAGATGCGCAAGAAGGTGTCTACCTCGCTGGAGAAGAAGATGGGCAGCGGCCCG
GCCAAGATTCGGGAGGTTGATGTGCCTCTACCCGGCGGTCCAGCTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail