Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00900
Gene name
Locationscaffold_01:3447208..3448161
Strand+
Gene length (bp)953
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 9.7E-06 23 87

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 182 204 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 80.31 43.91 116.72
Alive In ants, during behavior modification 82.53 43.33 121.72
Dead In ants, recently dead 101.52 56.25 146.79

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.917630 no
Alive Dead 0.252465 no
Dead Fungus 0.254696 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00900
MGRLAPLVVVAALTISNAAAQNPGTPPCIPECANRVRADFAKFTCQNANDAACLCTKDNFSFGVRDCGAHCGAND
DNVRQFLLGSFCAGGVFPQSASTQAQATPTSPLASTQPLSTSAIPSTTQQTTSSFTNASSSIVTTSSSATSASET
SSDVEAAPPSSTSTEAEVSTAPAGSSSQGTVIGIGIGVGAAVIALAGVVICFLLRGRKQKPRHSIEISKPLPGSG
RAYAGRERNSFEKQGNDIEMTSHRYEDMVPRQQPRTMV*
Coding >Ophcf2|00900
ATGGGCCGTCTCGCGCCGCTTGTCGTCGTCGCCGCTTTAACCATCTCCAACGCCGCTGCTCAGAACCCTGGGACG
CCACCATGCATCCCAGAATGCGCCAACCGAGTGAGGGCCGACTTCGCCAAGTTCACATGTCAGAACGCGAATGAT
GCCGCCTGTCTTTGCACCAAGGACAACTTTTCCTTCGGAGTTCGCGACTGTGGCGCCCACTGTGGCGCCAACGAT
GACAACGTCCGCCAGTTTCTGCTCGGCTCCTTTTGTGCAGGCGGCGTGTTTCCGCAGTCCGCCTCTACTCAGGCA
CAGGCCACGCCCACTTCTCCCCTGGCGTCGACGCAACCGTTGTCCACCAGTGCCATACCGTCCACGACGCAGCAG
ACTACATCTTCGTTCACAAATGCGTCGTCCTCCATCGTCACGACCTCGAGTTCTGCGACTTCTGCCTCGGAAACG
TCCTCAGATGTGGAAGCTGCCCCTCCGAGTTCCACGTCTACCGAAGCAGAAGTGAGCACTGCGCCAGCTGGCAGC
TCATCTCAGGGGACCGTCATCGGCATCGGTATTGGCGTGGGAGCTGCTGTCATTGCCCTCGCCGGCGTCGTCATC
TGCTTCTTGCTTCGCGGTCGCAAACAGAAACCCCGTCACTCGATTGAGATCTCCAAGCCGCTCCCTGGGTCGGGT
AGAGCTTATGCGGGCCGCGAACGCAACTCGTTCGAGAAGCAGGGCAACGATATCGAGATGACGTCGCACCGTTAT
GAAGACATGGTGCCCCGCCAGCAGCCGAGGACCATGGTTTAA
Transcript >Ophcf2|00900
ATGGGCCGTCTCGCGCCGCTTGTCGTCGTCGCCGCTTTAACCATCTCCAACGCCGCTGCTCAGAACCCTGGGACG
CCACCATGCATCCCAGAATGCGCCAACCGAGTGAGGGCCGACTTCGCCAAGTTCACATGTCAGAACGCGAATGAT
GCCGCCTGTCTTTGCACCAAGGACAACTTTTCCTTCGGAGTTCGCGACTGTGGCGCCCACTGTGGCGCCAACGAT
GACAACGTCCGCCAGTTTCTGCTCGGCTCCTTTTGTGCAGGCGGCGTGTTTCCGCAGTCCGCCTCTACTCAGGCA
CAGGCCACGCCCACTTCTCCCCTGGCGTCGACGCAACCGTTGTCCACCAGTGCCATACCGTCCACGACGCAGCAG
ACTACATCTTCGTTCACAAATGCGTCGTCCTCCATCGTCACGACCTCGAGTTCTGCGACTTCTGCCTCGGAAACG
TCCTCAGATGTGGAAGCTGCCCCTCCGAGTTCCACGTCTACCGAAGCAGAAGTGAGCACTGCGCCAGCTGGCAGC
TCATCTCAGGGGACCGTCATCGGCATCGGTATTGGCGTGGGAGCTGCTGTCATTGCCCTCGCCGGCGTCGTCATC
TGCTTCTTGCTTCGCGGTCGCAAACAGAAACCCCGTCACTCGATTGAGATCTCCAAGCCGCTCCCTGGGTCGGGT
AGAGCTTATGCGGGCCGCGAACGCAACTCGTTCGAGAAGCAGGGCAACGATATCGAGATGACGTCGCACCGTTAT
GAAGACATGGTGCCCCGCCAGCAGCCGAGGACCATGGTTTAA
Gene >Ophcf2|00900
ATGGGCCGTCTCGCGCCGCTTGTCGTCGTCGCCGCTTTAACCATCTCCAACGCCGCTGCTCAGAACCCTGGGACG
CCACCATGCATCGTGAGAAGCGTCGCTTCCCGCACCCAAGAACGTTCATCGCTGACCTCATCAACAGCCAGAATG
CGCCAACCGAGTGAGGGCCGACTTCGCCAAGTTCACATGTCAGAACGCGAATGATGCCGCCTGTCTTTGCACCAA
GGACAACTTTTCCTTCGGAGTTCGCGACTGTGGCGCCCACTGTGGCGCCAACGATGACAACGTCCGCCAGTTTCT
GCTCGGCTCCTTTTGTGCAGGTAAAGAAGATGGCGTCGCTTTCTACCCTCAGTCCCCGACTGACACCCGATATAG
GCGGCGTGTTTCCGCAGTCCGCCTCTACTCAGGCACAGGCCACGCCCACTTCTCCCCTGGCGTCGACGCAACCGT
TGTCCACCAGTGCCATACCGTCCACGACGCAGCAGACTACATCTTCGTTCACAAATGCGTCGTCCTCCATCGTCA
CGACCTCGAGTGTGAGTCGGAAAGCTGGTCATGAGTCCTGATTCGGCTAACAGACATGCCAGTCTGCGACTTCTG
CCTCGGAAACGTCCTCAGATGTGGAAGCTGCCCCTCCGAGTTCCACGTCTACCGAAGCAGAAGTGAGCACTGCGC
CAGCTGGCAGCTCATCTCAGGGGACCGTCATCGGCATCGGTATTGGCGTGGGAGCTGCTGTCATTGCCCTCGCCG
GCGTCGTCATCTGCTTCTTGCTTCGCGGTCGCAAACAGAAACCCCGTCACTCGATTGAGATCTCCAAGCCGCTCC
CTGGGTCGGGTAGAGCTTATGCGGGCCGCGAACGCAACTCGTTCGAGAAGCAGGGCAACGATATCGAGATGACGT
CGCACCGTTATGAAGACATGGTGCCCCGCCAGCAGCCGAGGACCATGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail