Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00900
Gene name
Locationscaffold_01:3447208..3448161
Strand+
Gene length (bp)953
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 9.7E-06 23 87

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide 0.0978 0.0988 0.6328 0.5956 0.1433 0.0069 0.0654 0.2918 0.1514 0.0226

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999768

Transmembrane Domains

Domain # Start End Length
1 182 204 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2920
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6355
Ophiocordyceps australis map64 (Brazil) OphauB2|102
Ophiocordyceps camponoti-floridani Ophcf2|00900 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5143
Ophiocordyceps kimflemingae Ophio5|731
Ophiocordyceps subramaniannii Hirsu2|49

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00900
MGRLAPLVVVAALTISNAAAQNPGTPPCIPECANRVRADFAKFTCQNANDAACLCTKDNFSFGVRDCGAHCGAND
DNVRQFLLGSFCAGGVFPQSASTQAQATPTSPLASTQPLSTSAIPSTTQQTTSSFTNASSSIVTTSSSATSASET
SSDVEAAPPSSTSTEAEVSTAPAGSSSQGTVIGIGIGVGAAVIALAGVVICFLLRGRKQKPRHSIEISKPLPGSG
RAYAGRERNSFEKQGNDIEMTSHRYEDMVPRQQPRTMV*
Coding >Ophcf2|00900
ATGGGCCGTCTCGCGCCGCTTGTCGTCGTCGCCGCTTTAACCATCTCCAACGCCGCTGCTCAGAACCCTGGGACG
CCACCATGCATCCCAGAATGCGCCAACCGAGTGAGGGCCGACTTCGCCAAGTTCACATGTCAGAACGCGAATGAT
GCCGCCTGTCTTTGCACCAAGGACAACTTTTCCTTCGGAGTTCGCGACTGTGGCGCCCACTGTGGCGCCAACGAT
GACAACGTCCGCCAGTTTCTGCTCGGCTCCTTTTGTGCAGGCGGCGTGTTTCCGCAGTCCGCCTCTACTCAGGCA
CAGGCCACGCCCACTTCTCCCCTGGCGTCGACGCAACCGTTGTCCACCAGTGCCATACCGTCCACGACGCAGCAG
ACTACATCTTCGTTCACAAATGCGTCGTCCTCCATCGTCACGACCTCGAGTTCTGCGACTTCTGCCTCGGAAACG
TCCTCAGATGTGGAAGCTGCCCCTCCGAGTTCCACGTCTACCGAAGCAGAAGTGAGCACTGCGCCAGCTGGCAGC
TCATCTCAGGGGACCGTCATCGGCATCGGTATTGGCGTGGGAGCTGCTGTCATTGCCCTCGCCGGCGTCGTCATC
TGCTTCTTGCTTCGCGGTCGCAAACAGAAACCCCGTCACTCGATTGAGATCTCCAAGCCGCTCCCTGGGTCGGGT
AGAGCTTATGCGGGCCGCGAACGCAACTCGTTCGAGAAGCAGGGCAACGATATCGAGATGACGTCGCACCGTTAT
GAAGACATGGTGCCCCGCCAGCAGCCGAGGACCATGGTTTAA
Transcript >Ophcf2|00900
ATGGGCCGTCTCGCGCCGCTTGTCGTCGTCGCCGCTTTAACCATCTCCAACGCCGCTGCTCAGAACCCTGGGACG
CCACCATGCATCCCAGAATGCGCCAACCGAGTGAGGGCCGACTTCGCCAAGTTCACATGTCAGAACGCGAATGAT
GCCGCCTGTCTTTGCACCAAGGACAACTTTTCCTTCGGAGTTCGCGACTGTGGCGCCCACTGTGGCGCCAACGAT
GACAACGTCCGCCAGTTTCTGCTCGGCTCCTTTTGTGCAGGCGGCGTGTTTCCGCAGTCCGCCTCTACTCAGGCA
CAGGCCACGCCCACTTCTCCCCTGGCGTCGACGCAACCGTTGTCCACCAGTGCCATACCGTCCACGACGCAGCAG
ACTACATCTTCGTTCACAAATGCGTCGTCCTCCATCGTCACGACCTCGAGTTCTGCGACTTCTGCCTCGGAAACG
TCCTCAGATGTGGAAGCTGCCCCTCCGAGTTCCACGTCTACCGAAGCAGAAGTGAGCACTGCGCCAGCTGGCAGC
TCATCTCAGGGGACCGTCATCGGCATCGGTATTGGCGTGGGAGCTGCTGTCATTGCCCTCGCCGGCGTCGTCATC
TGCTTCTTGCTTCGCGGTCGCAAACAGAAACCCCGTCACTCGATTGAGATCTCCAAGCCGCTCCCTGGGTCGGGT
AGAGCTTATGCGGGCCGCGAACGCAACTCGTTCGAGAAGCAGGGCAACGATATCGAGATGACGTCGCACCGTTAT
GAAGACATGGTGCCCCGCCAGCAGCCGAGGACCATGGTTTAA
Gene >Ophcf2|00900
ATGGGCCGTCTCGCGCCGCTTGTCGTCGTCGCCGCTTTAACCATCTCCAACGCCGCTGCTCAGAACCCTGGGACG
CCACCATGCATCGTGAGAAGCGTCGCTTCCCGCACCCAAGAACGTTCATCGCTGACCTCATCAACAGCCAGAATG
CGCCAACCGAGTGAGGGCCGACTTCGCCAAGTTCACATGTCAGAACGCGAATGATGCCGCCTGTCTTTGCACCAA
GGACAACTTTTCCTTCGGAGTTCGCGACTGTGGCGCCCACTGTGGCGCCAACGATGACAACGTCCGCCAGTTTCT
GCTCGGCTCCTTTTGTGCAGGTAAAGAAGATGGCGTCGCTTTCTACCCTCAGTCCCCGACTGACACCCGATATAG
GCGGCGTGTTTCCGCAGTCCGCCTCTACTCAGGCACAGGCCACGCCCACTTCTCCCCTGGCGTCGACGCAACCGT
TGTCCACCAGTGCCATACCGTCCACGACGCAGCAGACTACATCTTCGTTCACAAATGCGTCGTCCTCCATCGTCA
CGACCTCGAGTGTGAGTCGGAAAGCTGGTCATGAGTCCTGATTCGGCTAACAGACATGCCAGTCTGCGACTTCTG
CCTCGGAAACGTCCTCAGATGTGGAAGCTGCCCCTCCGAGTTCCACGTCTACCGAAGCAGAAGTGAGCACTGCGC
CAGCTGGCAGCTCATCTCAGGGGACCGTCATCGGCATCGGTATTGGCGTGGGAGCTGCTGTCATTGCCCTCGCCG
GCGTCGTCATCTGCTTCTTGCTTCGCGGTCGCAAACAGAAACCCCGTCACTCGATTGAGATCTCCAAGCCGCTCC
CTGGGTCGGGTAGAGCTTATGCGGGCCGCGAACGCAACTCGTTCGAGAAGCAGGGCAACGATATCGAGATGACGT
CGCACCGTTATGAAGACATGGTGCCCCGCCAGCAGCCGAGGACCATGGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail