Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00893
Gene name
Locationscaffold_01:3417481..3421330
Strand-
Gene length (bp)3849
Transcript length (bp)3723
Coding sequence length (bp)3723
Protein length (aa) 1241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 2.6E-70 923 1200
PF15405 PH_5 Pleckstrin homology domain 2.6E-43 765 889
PF00621 RhoGEF RhoGEF domain 1.4E-34 542 727
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 2.0E-14 373 440

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6185 0.328 0.1324 0.1917 0.0804 0.006 0.0944 0.3768 0.2345 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1544
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4980
Ophiocordyceps australis map64 (Brazil) OphauB2|1948
Ophiocordyceps camponoti-floridani Ophcf2|00893 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2381
Ophiocordyceps kimflemingae Ophio5|736
Ophiocordyceps subramaniannii Hirsu2|11267

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00893
MADYHYDPRAAPQRPRAYPDSNNHHQRDAAFSNIFGAAPPPGRSQTMTASSSHPAMMEPGRTQTMSMGSGPPRQP
PGRVQQPYLYGAEHARSGPYAAHYAAQRSASGSQSSTSSQPQQSPQQQYQQQQQQPPRRPYTGVGGPAPPRFEAR
PTPQATAMRYQPQRSYQNAPSPALNSDPYRSQSLASMPRPQIYHPPPSSYQQQHSPANHSRYAQYGQQNSARTTA
QGRIVPERHEDRAMSMTGGGFHPQDRDAHQTMSGRVIPNRRAPSDPANGYPLQGAAYSNMPGAQTRATGMSSPTG
TSSDHSRSMSMASSIAPTIVASDSDPSTPTQRPSRSKSIESERPPTATKIRPPLVYPALLSRVAECFRRKIILGD
RTKNELTYKNAFSGSEAVDVLSYIIRTTDRNLALLLGRALDAQKFFHDVTYEHRLRDSMSEMYQLRETLMDEPED
KSPVNGIFVLLSECYSPTCTRDQLCYSIACPRRLEQVSRLNLKTGPGLRKEDSANVNDDEADQTDEQKLWINSVP
KEIADAVGEREKKRQEVISEICYTERDFVKDLEYLRDFWINPLRSKASPIPLQRREKAVKNIFSNIVDHPSIHSV
SSRFAVSLTGRQGKEPIVYNIGDIFLEYVPQFEPFITYGSRQLEGKFEFENERSINPMFGKFVDEIERRKESRKL
ELNGYLTKPTTRLARYPLLLENVLKYTEADNPDKTDIPKVLTMIRDLLGRVNAESGKAENRFNLRRLHDQLRFRP
NERVDLKLTEEGRELVFKSQLKKSPTDPTEITAFLFDHAVLLVRIKQSGKNEEIKAYRRPIPLELLSIREMDEVI
PAQGVKRSSSSLIPSIRTNNSEAKKGEGWPITFRHLGKAGYELALFAANQAARKKWLEFIDNAQQRLRSRADFFN
TTIVSSSFFVGANQIRCVTPFDGGRKLLYGTDNGIYLSDRKNREQVPRRVLETTNVTQIDILEEYQLLLVLSNKT
LHSYSISVLNPDEAALARRPKKIQNHCSFFKTGICMGRHLVCCVKSSALSTTIKVFEPNDAMTKAKKQKGLGKFM
AGQDELRPFKEFYIPTESSSVHFLKSKLCVACARGFEVVSLETLETQALLDQADTSLDFVARKEGVKPIHIERLN
GEFLLNYSEFSFFVNRNGWRARPEWRIDWEGTPQSFALSYPWILAFEANFIELRNIENGAVHIVPHKNIRMLHSS
THEILFAYEDERGEDVVEAIDFWKNTRRTEPAAGQASSGR*
Coding >Ophcf2|00893
ATGGCCGATTATCACTATGACCCTCGAGCAGCTCCCCAGCGCCCTCGCGCCTATCCCGACTCGAATAATCATCAC
CAGCGCGACGCCGCCTTCTCCAACATCTTCGGCGCTGCCCCTCCTCCGGGCCGATCCCAAACCATGACCGCCTCC
TCCTCGCATCCCGCCATGATGGAGCCGGGTAGAACCCAGACCATGTCGATGGGCTCCGGTCCGCCTCGCCAGCCC
CCGGGGCGCGTCCAACAACCATATCTCTACGGCGCCGAGCACGCTAGATCCGGCCCCTACGCCGCTCACTATGCC
GCCCAGCGTTCGGCTTCGGGCAGCCAGTCGTCGACCTCCTCCCAGCCGCAGCAATCACCGCAACAACAATACCAA
CAACAGCAGCAGCAGCCGCCCAGGAGACCCTACACGGGCGTCGGAGGCCCTGCACCGCCGCGATTCGAGGCTCGG
CCCACGCCACAGGCAACTGCGATGCGCTATCAACCACAAAGATCCTATCAGAACGCCCCCTCCCCGGCCCTCAAC
AGCGACCCCTACCGTTCCCAGTCGTTGGCCTCCATGCCGCGTCCGCAAATATACCACCCTCCGCCGAGCTCCTAC
CAGCAGCAGCACTCGCCCGCGAACCACTCCCGTTACGCCCAGTATGGCCAGCAGAACTCGGCCCGGACGACGGCG
CAAGGCCGCATCGTGCCAGAACGTCACGAGGACCGGGCCATGTCCATGACTGGAGGGGGCTTCCACCCGCAGGAC
AGGGACGCTCACCAGACCATGAGCGGACGCGTCATCCCGAATCGACGGGCCCCGTCAGACCCTGCTAACGGCTAC
CCGCTGCAGGGCGCCGCCTACTCCAACATGCCTGGTGCGCAGACGCGCGCCACCGGCATGAGCTCGCCCACCGGC
ACCTCGTCTGACCACTCGAGGTCCATGTCGATGGCGTCTAGCATCGCGCCGACGATTGTGGCCTCGGACTCGGAT
CCCTCCACGCCCACGCAGCGACCGTCTAGGAGCAAGTCGATCGAGAGCGAGCGGCCCCCGACGGCCACCAAGATA
CGGCCGCCGCTGGTCTACCCGGCCCTGCTGTCGCGCGTCGCCGAGTGCTTCCGGCGCAAGATCATCCTCGGCGAC
CGGACCAAGAACGAGTTGACGTACAAGAATGCCTTCAGCGGCTCCGAGGCCGTTGATGTGCTGTCGTACATCATC
AGGACGACGGACCGGAACCTGGCCCTCCTTCTGGGTCGCGCCCTGGACGCGCAAAAGTTCTTCCATGATGTCACG
TACGAACACCGGCTGCGAGATTCCATGTCGGAGATGTACCAGCTCCGCGAGACGCTCATGGATGAGCCCGAAGAC
AAGTCACCCGTCAACGGCATCTTCGTCTTGCTCTCCGAGTGCTACTCGCCCACGTGCACGCGGGACCAGCTCTGC
TACTCCATCGCCTGCCCCCGGCGTCTGGAGCAGGTGTCGAGGCTGAACCTCAAGACGGGCCCCGGCCTGCGCAAG
GAGGACTCGGCCAACGTCAACGACGATGAGGCCGACCAGACGGACGAGCAGAAGCTCTGGATCAACTCGGTGCCC
AAGGAGATCGCCGACGCCGTGGGCGAGCGGGAGAAGAAGAGGCAAGAGGTCATCTCGGAGATTTGCTACACGGAG
CGCGACTTCGTCAAGGATCTCGAGTATCTGCGCGACTTTTGGATCAACCCCCTGCGGTCCAAGGCGTCTCCCATC
CCGCTCCAGCGAAGGGAGAAGGCGGTCAAGAACATCTTTAGCAACATCGTCGACCACCCAAGCATCCACTCGGTG
AGCTCACGCTTCGCCGTGTCCCTGACGGGGCGGCAAGGCAAGGAGCCCATCGTGTACAACATTGGCGACATCTTC
CTCGAGTACGTGCCGCAGTTCGAGCCCTTTATAACGTACGGGTCCCGGCAGCTCGAGGGCAAGTTTGAGTTTGAG
AACGAACGGTCCATCAACCCGATGTTTGGCAAGTTTGTCGACGAGATCGAGCGGCGGAAGGAGTCGCGCAAGCTG
GAGCTCAACGGCTACCTGACGAAGCCGACGACGCGGTTGGCGCGATATCCGCTGCTGCTGGAGAACGTGCTCAAG
TACACCGAGGCCGATAACCCGGACAAGACGGATATCCCCAAGGTGCTCACCATGATCCGCGACCTGCTGGGGAGA
GTCAACGCCGAGTCGGGCAAGGCGGAGAACCGGTTCAACCTGCGGCGGCTGCACGACCAGCTACGGTTCCGGCCC
AACGAGCGCGTCGACCTGAAGCTGACGGAGGAGGGCCGCGAGCTGGTGTTCAAGAGCCAGCTCAAGAAGTCGCCG
ACGGACCCGACGGAGATTACAGCCTTCCTCTTCGATCACGCCGTCTTGTTGGTGCGCATCAAGCAGAGCGGCAAG
AACGAAGAGATCAAGGCGTACCGGAGGCCGATTCCGCTCGAGCTGCTGTCGATCCGCGAGATGGACGAGGTGATT
CCGGCGCAGGGTGTTAAGCGGTCGTCGTCGAGCTTGATCCCGTCGATTCGGACCAACAACTCGGAGGCCAAGAAG
GGCGAGGGCTGGCCCATTACGTTCCGACACCTGGGCAAGGCTGGGTACGAGCTGGCGCTGTTCGCGGCCAACCAG
GCGGCTCGCAAGAAGTGGCTCGAGTTTATCGACAATGCCCAGCAGCGGCTACGATCGCGGGCAGACTTTTTCAAC
ACGACGATTGTGTCGAGCAGCTTCTTTGTGGGCGCCAACCAGATTCGCTGTGTGACGCCGTTTGACGGCGGCCGG
AAGCTGCTGTACGGAACCGACAACGGCATCTACCTCTCGGACCGCAAGAACCGCGAACAGGTGCCTCGGCGGGTG
CTGGAGACGACCAACGTGACGCAAATCGACATACTGGAGGAGTACCAGCTACTGCTGGTGCTATCCAACAAGACG
CTACACTCGTACTCCATCTCGGTGCTGAACCCGGACGAGGCGGCGCTGGCGAGACGGCCCAAGAAGATACAGAAT
CACTGCAGCTTCTTCAAGACGGGTATCTGCATGGGACGACACCTGGTATGCTGCGTCAAGTCTTCGGCGCTATCG
ACGACGATCAAGGTGTTTGAGCCCAACGACGCCATGACCAAGGCCAAGAAGCAAAAGGGGCTGGGCAAGTTTATG
GCGGGTCAGGACGAGCTGCGACCGTTCAAGGAGTTTTACATTCCCACGGAGTCATCGTCGGTGCACTTCCTCAAG
TCGAAGCTCTGCGTCGCCTGCGCCCGCGGCTTCGAGGTCGTCTCGCTCGAGACGCTCGAGACGCAGGCGCTTCTG
GACCAGGCAGACACGTCGCTCGACTTTGTGGCGCGCAAAGAGGGCGTCAAGCCGATTCACATCGAGCGCCTCAAC
GGCGAGTTCCTGCTCAACTACTCCGAGTTTTCCTTCTTCGTCAACCGCAACGGCTGGCGGGCGCGGCCCGAATGG
CGTATCGACTGGGAGGGCACGCCCCAGAGCTTCGCCCTCAGTTACCCCTGGATCCTGGCCTTTGAGGCCAACTTT
ATCGAGCTGCGAAATATCGAGAACGGGGCGGTGCACATTGTGCCGCACAAGAACATACGGATGCTACACAGCAGC
ACGCACGAGATACTGTTTGCGTACGAGGACGAGCGAGGAGAGGACGTGGTCGAGGCCATTGACTTTTGGAAGAAT
ACCAGACGGACCGAGCCGGCGGCGGGACAGGCGTCGTCGGGGCGGTAG
Transcript >Ophcf2|00893
ATGGCCGATTATCACTATGACCCTCGAGCAGCTCCCCAGCGCCCTCGCGCCTATCCCGACTCGAATAATCATCAC
CAGCGCGACGCCGCCTTCTCCAACATCTTCGGCGCTGCCCCTCCTCCGGGCCGATCCCAAACCATGACCGCCTCC
TCCTCGCATCCCGCCATGATGGAGCCGGGTAGAACCCAGACCATGTCGATGGGCTCCGGTCCGCCTCGCCAGCCC
CCGGGGCGCGTCCAACAACCATATCTCTACGGCGCCGAGCACGCTAGATCCGGCCCCTACGCCGCTCACTATGCC
GCCCAGCGTTCGGCTTCGGGCAGCCAGTCGTCGACCTCCTCCCAGCCGCAGCAATCACCGCAACAACAATACCAA
CAACAGCAGCAGCAGCCGCCCAGGAGACCCTACACGGGCGTCGGAGGCCCTGCACCGCCGCGATTCGAGGCTCGG
CCCACGCCACAGGCAACTGCGATGCGCTATCAACCACAAAGATCCTATCAGAACGCCCCCTCCCCGGCCCTCAAC
AGCGACCCCTACCGTTCCCAGTCGTTGGCCTCCATGCCGCGTCCGCAAATATACCACCCTCCGCCGAGCTCCTAC
CAGCAGCAGCACTCGCCCGCGAACCACTCCCGTTACGCCCAGTATGGCCAGCAGAACTCGGCCCGGACGACGGCG
CAAGGCCGCATCGTGCCAGAACGTCACGAGGACCGGGCCATGTCCATGACTGGAGGGGGCTTCCACCCGCAGGAC
AGGGACGCTCACCAGACCATGAGCGGACGCGTCATCCCGAATCGACGGGCCCCGTCAGACCCTGCTAACGGCTAC
CCGCTGCAGGGCGCCGCCTACTCCAACATGCCTGGTGCGCAGACGCGCGCCACCGGCATGAGCTCGCCCACCGGC
ACCTCGTCTGACCACTCGAGGTCCATGTCGATGGCGTCTAGCATCGCGCCGACGATTGTGGCCTCGGACTCGGAT
CCCTCCACGCCCACGCAGCGACCGTCTAGGAGCAAGTCGATCGAGAGCGAGCGGCCCCCGACGGCCACCAAGATA
CGGCCGCCGCTGGTCTACCCGGCCCTGCTGTCGCGCGTCGCCGAGTGCTTCCGGCGCAAGATCATCCTCGGCGAC
CGGACCAAGAACGAGTTGACGTACAAGAATGCCTTCAGCGGCTCCGAGGCCGTTGATGTGCTGTCGTACATCATC
AGGACGACGGACCGGAACCTGGCCCTCCTTCTGGGTCGCGCCCTGGACGCGCAAAAGTTCTTCCATGATGTCACG
TACGAACACCGGCTGCGAGATTCCATGTCGGAGATGTACCAGCTCCGCGAGACGCTCATGGATGAGCCCGAAGAC
AAGTCACCCGTCAACGGCATCTTCGTCTTGCTCTCCGAGTGCTACTCGCCCACGTGCACGCGGGACCAGCTCTGC
TACTCCATCGCCTGCCCCCGGCGTCTGGAGCAGGTGTCGAGGCTGAACCTCAAGACGGGCCCCGGCCTGCGCAAG
GAGGACTCGGCCAACGTCAACGACGATGAGGCCGACCAGACGGACGAGCAGAAGCTCTGGATCAACTCGGTGCCC
AAGGAGATCGCCGACGCCGTGGGCGAGCGGGAGAAGAAGAGGCAAGAGGTCATCTCGGAGATTTGCTACACGGAG
CGCGACTTCGTCAAGGATCTCGAGTATCTGCGCGACTTTTGGATCAACCCCCTGCGGTCCAAGGCGTCTCCCATC
CCGCTCCAGCGAAGGGAGAAGGCGGTCAAGAACATCTTTAGCAACATCGTCGACCACCCAAGCATCCACTCGGTG
AGCTCACGCTTCGCCGTGTCCCTGACGGGGCGGCAAGGCAAGGAGCCCATCGTGTACAACATTGGCGACATCTTC
CTCGAGTACGTGCCGCAGTTCGAGCCCTTTATAACGTACGGGTCCCGGCAGCTCGAGGGCAAGTTTGAGTTTGAG
AACGAACGGTCCATCAACCCGATGTTTGGCAAGTTTGTCGACGAGATCGAGCGGCGGAAGGAGTCGCGCAAGCTG
GAGCTCAACGGCTACCTGACGAAGCCGACGACGCGGTTGGCGCGATATCCGCTGCTGCTGGAGAACGTGCTCAAG
TACACCGAGGCCGATAACCCGGACAAGACGGATATCCCCAAGGTGCTCACCATGATCCGCGACCTGCTGGGGAGA
GTCAACGCCGAGTCGGGCAAGGCGGAGAACCGGTTCAACCTGCGGCGGCTGCACGACCAGCTACGGTTCCGGCCC
AACGAGCGCGTCGACCTGAAGCTGACGGAGGAGGGCCGCGAGCTGGTGTTCAAGAGCCAGCTCAAGAAGTCGCCG
ACGGACCCGACGGAGATTACAGCCTTCCTCTTCGATCACGCCGTCTTGTTGGTGCGCATCAAGCAGAGCGGCAAG
AACGAAGAGATCAAGGCGTACCGGAGGCCGATTCCGCTCGAGCTGCTGTCGATCCGCGAGATGGACGAGGTGATT
CCGGCGCAGGGTGTTAAGCGGTCGTCGTCGAGCTTGATCCCGTCGATTCGGACCAACAACTCGGAGGCCAAGAAG
GGCGAGGGCTGGCCCATTACGTTCCGACACCTGGGCAAGGCTGGGTACGAGCTGGCGCTGTTCGCGGCCAACCAG
GCGGCTCGCAAGAAGTGGCTCGAGTTTATCGACAATGCCCAGCAGCGGCTACGATCGCGGGCAGACTTTTTCAAC
ACGACGATTGTGTCGAGCAGCTTCTTTGTGGGCGCCAACCAGATTCGCTGTGTGACGCCGTTTGACGGCGGCCGG
AAGCTGCTGTACGGAACCGACAACGGCATCTACCTCTCGGACCGCAAGAACCGCGAACAGGTGCCTCGGCGGGTG
CTGGAGACGACCAACGTGACGCAAATCGACATACTGGAGGAGTACCAGCTACTGCTGGTGCTATCCAACAAGACG
CTACACTCGTACTCCATCTCGGTGCTGAACCCGGACGAGGCGGCGCTGGCGAGACGGCCCAAGAAGATACAGAAT
CACTGCAGCTTCTTCAAGACGGGTATCTGCATGGGACGACACCTGGTATGCTGCGTCAAGTCTTCGGCGCTATCG
ACGACGATCAAGGTGTTTGAGCCCAACGACGCCATGACCAAGGCCAAGAAGCAAAAGGGGCTGGGCAAGTTTATG
GCGGGTCAGGACGAGCTGCGACCGTTCAAGGAGTTTTACATTCCCACGGAGTCATCGTCGGTGCACTTCCTCAAG
TCGAAGCTCTGCGTCGCCTGCGCCCGCGGCTTCGAGGTCGTCTCGCTCGAGACGCTCGAGACGCAGGCGCTTCTG
GACCAGGCAGACACGTCGCTCGACTTTGTGGCGCGCAAAGAGGGCGTCAAGCCGATTCACATCGAGCGCCTCAAC
GGCGAGTTCCTGCTCAACTACTCCGAGTTTTCCTTCTTCGTCAACCGCAACGGCTGGCGGGCGCGGCCCGAATGG
CGTATCGACTGGGAGGGCACGCCCCAGAGCTTCGCCCTCAGTTACCCCTGGATCCTGGCCTTTGAGGCCAACTTT
ATCGAGCTGCGAAATATCGAGAACGGGGCGGTGCACATTGTGCCGCACAAGAACATACGGATGCTACACAGCAGC
ACGCACGAGATACTGTTTGCGTACGAGGACGAGCGAGGAGAGGACGTGGTCGAGGCCATTGACTTTTGGAAGAAT
ACCAGACGGACCGAGCCGGCGGCGGGACAGGCGTCGTCGGGGCGGTAG
Gene >Ophcf2|00893
ATGGCCGATTATCACTATGACCCTCGAGCAGCTCCCCAGCGCCCTCGCGCCTATCCCGACTCGAATAATCATCAC
CAGCGCGACGCCGCCTTCTCCAACATCTTCGGCGCTGCCCCTCCTCCGGGCCGATCCCAAACCATGACCGCCTCC
TCCTCGCATCCCGCCATGATGGAGCCGGGTAGAACCCAGACCATGTCGATGGGCTCCGGTCCGCCTCGCCAGCCC
CCGGGGCGCGTCCAACAACCATATCTCTACGGCGCCGAGCACGCTAGATCCGGCCCCTACGCCGCTCACTATGCC
GCCCAGCGTTCGGCTTCGGGCAGCCAGTCGTCGACCTCCTCCCAGCCGCAGCAATCACCGCAACAACAATACCAA
CAACAGCAGCAGCAGCCGCCCAGGAGACCCTACACGGGCGTCGGAGGCCCTGCACCGCCGCGATTCGAGGCTCGG
CCCACGCCACAGGCAACTGCGATGCGCTATCAACCACAAAGATCCTATCAGAACGCCCCCTCCCCGGCCCTCAAC
AGCGACCCCTACCGTTCCCAGTCGTTGGCCTCCATGCCGCGTCCGCAAATATACCACCCTCCGCCGAGCTCCTAC
CAGCAGCAGCACTCGCCCGCGAACCACTCCCGTTACGCCCAGTATGGCCAGCAGAACTCGGCCCGGACGACGGCG
CAAGGCCGCATCGTGCCAGAACGTCACGAGGACCGGGCCATGTCCATGACTGGAGGGGGCTTCCACCCGCAGGAC
AGGGACGCTCACCAGACCATGAGCGGACGCGTCATCCCGAATCGACGGGCCCCGTCAGACCCTGCTAACGGCTAC
CCGCTGCAGGGCGCCGCCTACTCCAACATGCCTGGTGCGCAGACGCGCGCCACCGGCATGAGCTCGCCCACCGGC
ACCTCGTCTGACCACTCGAGGTCCATGTCGATGGCGTCTAGCATCGCGCCGACGATTGTGGCCTCGGACTCGGAT
CCCTCCACGCCCACGCAGCGACCGTCTAGGAGCAAGTCGATCGAGAGCGAGCGGCCCCCGACGGCCACCAAGATA
CGGCCGCCGCTGGTCTACCCGGCCCTGCTGTCGCGCGTCGCCGAGTGCTTCCGGCGCAAGATCATCCTCGGCGAC
CGGACCAAGAACGAGTTGACGTACAAGAATGCCTTCAGCGGCTCCGAGGCCGTTGATGTGCTGTCGTACATCATC
AGGACGACGGACCGGAACCTGGCCCTCCTTCTGGGTCGCGCCCTGGACGCGCAAAAGTTCTTCCATGATGTCACG
TACGAACACCGGCTGCGAGATTCCATGTCGGAGATGTACCAGCTCCGCGAGACGCTCATGGATGAGCCCGAAGAC
AAGTCACCCGTCAACGGCATCTTCGTCTTGCTCTCCGAGTGCTACTCGCCCACGTGCACGCGGGACCAGCTCTGC
TACTCCATCGCCTGCCCCCGGCGTCTGGAGCAGGTGTCGAGGCTGAACCTCAAGACGGGCCCCGGCCTGCGCAAG
GAGGACTCGGCCAACGTCAACGACGATGAGGCCGACCAGACGGACGAGCAGAAGCTCTGGATCAACTCGGTGCCC
AAGGAGATCGCCGACGCCGTGGGCGAGCGGGAGAAGAAGAGGCAAGAGGTCATCTCGGAGATTTGCTACACGGAG
CGCGACTTCGTCAAGGATCTCGAGTATCTGCGCGACTTTTGGATCAACCCCCTGCGGTCCAAGGCGTCTCCCATC
CCGCTCCAGCGAAGGGAGAAGGCGGTCAAGAACATCTTTAGCAACATCGTCGACCACCCAAGCATCCACTCGGTG
AGCTCACGCTTCGCCGTGTCCCTGACGGGGCGGCAAGGCAAGGAGCCCATCGTGTACAACATTGGCGACATCTTC
CTCGAGTACGTGCCGCAGTTCGAGCCCTTTATAACGTACGGGTCCCGGCAGCTCGAGGGCAAGTTTGAGTTTGAG
AACGAACGGTCCATCAACCCGATGTTTGGCAAGTTTGTCGACGAGATCGAGCGGCGGAAGGAGTCGCGCAAGCTG
GAGCTCAACGGCTACCTGACGAAGCCGACGACGCGGTTGGCGCGATATCCGCTGCTGCTGGAGAACGTGCTCAAG
TACACCGAGGCCGATAACCCGGACAAGACGGATATCCCCAAGGTGCTCACCATGATCCGCGACCTGCTGGGGAGA
GTCAACGCCGAGTCGGGCAAGGCGGAGAACCGGTTCAACCTGCGGCGGCTGCACGACCAGCTACGGTTCCGGCCC
AACGAGCGCGTCGACCTGAAGCTGACGGAGGAGGGCCGCGAGCTGGTGTTCAAGAGCCAGCTCAAGAAGTCGCCG
ACGGACCCGACGGAGATTACAGCCTTCCTCTTCGATCACGCCGTCTTGTTGGTGCGCATCAAGCAGAGCGGCAAG
AACGAAGAGATCAAGGCGTACCGGAGGCCGATTCCGCTCGAGCTGCTGTCGATCCGCGAGATGGACGAGGTGATT
CCGGCGCAGGGTGTTAAGCGGTCGTCGTCGAGCTTGATCCCGTCGATTCGGACCAACAACTCGGAGGCCAAGAAG
GGCGAGGGCTGGCCCATTACGTTCCGACACCTGGGCAAGGCTGGGTACGAGCTGGCGCTGTTCGCGGCCAACCAG
GCGGCTCGCAAGAAGTGGCTCGAGTTTATCGACAATGCCCAGCAGCGGCTACGATCGCGGGCAGACTTTTTCAAC
ACGACGATTGTGTCGAGCAGCTTCTTTGTGGGCGCCAACCAGATTCGCTGTGTGACGCCGTTTGGTGAGTCTTTT
TTCTTTCTTTTTTTCTTTTTCTGCTCCTCTATGCTGCATCACTGCTGACGTCCAGCTACAGACGGCGGCCGGAAG
CTGCTGTACGGAACCGACAACGGCATCTACCTCTCGGACCGCAAGAACCGCGAACAGGTGCCTCGGCGGGTGCTG
GAGACGACCAACGTGACGCAAATCGACATACTGGAGGAGTACCAGCTACTGCTGGTGCTATCCAACAAGACGCTA
CACTCGTACTCCATCTCGGTGCTGAACCCGGACGAGGCGGCGCTGGCGAGACGGCCCAAGAAGATACAGAATCAC
TGCAGCTTCTTCAAGACGGGTATCTGCATGGGACGACACCTGGTATGCTGCGTCAAGTCTTCGGCGCTATCGACG
ACGATCAAGGTGTTTGAGCCCAACGACGCCATGACCAAGGCCAAGAAGCAAAAGGGGCTGGGCAAGTTTATGGCG
GGTCAGGACGAGCTGCGACCGTTCAAGGAGTTTTACATTCCCACGGAGTCATCGTCGGTGCACTTCCTCAAGTCG
AAGCTCTGCGTCGCCTGCGCCCGCGGCTTCGAGGTCGTCTCGCTCGAGACGCTCGAGACGCAGGCGCTTCTGGAC
CAGGCAGACACGTCGCTCGACTTTGTGGCGCGCAAAGAGGGCGTCAAGCCGATTCACATCGAGCGCCTCAACGGC
GAGTTCCTGCTCAACTACTCCGAGTTTTCCTTCTTCGTCAACCGCAACGGCTGGCGGGCGCGGCCCGAATGGCGT
ATCGACTGGGAGGGCACGCCCCAGAGCTTCGCCCTCAGTTACCCCTGGATCCTGGCCTTTGAGGCCAACTTTATC
GAGCTGCGAAATATCGAGAACGGGGCGGTGCACATTGTGCCGCACAAGAACATACGGATGCTACACAGCAGCACG
CACGAGGTGGGCTGACGCCATTTCAAAATCGTGTCTGTCTTGGTCACTGACGTGAAGCAGATACTGTTTGCGTAC
GAGGACGAGCGAGGAGAGGACGTGGTCGAGGCCATTGACTTTTGGAAGAATACCAGACGGACCGAGCCGGCGGCG
GGACAGGCGTCGTCGGGGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail