Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00891
Gene name
Locationscaffold_01:3408498..3411941
Strand+
Gene length (bp)3443
Transcript length (bp)3336
Coding sequence length (bp)3336
Protein length (aa) 1112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.7E-46 282 486

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.429 0.274 0.1471 0.1845 0.1095 0.0289 0.1524 0.5866 0.6047 0.0098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4685
Ophiocordyceps australis map64 (Brazil) OphauB2|1953
Ophiocordyceps camponoti-floridani Ophcf2|00891 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4190
Ophiocordyceps kimflemingae Ophio5|8452
Ophiocordyceps subramaniannii Hirsu2|3170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00891
MFSNLTNIVHRAQQLIDPTQGLNLSNSDRNPSKASLFQSQFRLPPSQTPLCEINAELTIPPSNATRGDRDRGWHY
AGKLHLSESYMCFSTTPTSFLQSASTSTSSAFTGQTHGAGPSGNGFTFPLCAIRRVERLNSQNFQFALAITTWNG
LLAVEDDKDADKDHAREQRITLHLAGSRLACEKFCDGLKRGLRAGVGSLAKLRGVVAECYSQHLLRPDDRKTAAP
PDAGLGMLFRYPGDAKKLRDRAKMRLWAEYLRDNGRNVTLIRQPTFHKLIRVGLPNRLRGEMWELTSGSLYLRLE
KPTLYADTLQKFHGQESLAIDEIEKDLNRSLPEYPGFQSQDGIGRLRRVLTAYSWLNADVGYCQAMNIVVAALLI
YMSESQAFFLLSALCDRLVPGYYSTTMYGTLLDQKVFESLVERTMPVLWDHLVKSDVQLSVVSLPWFLSLYVNSM
PLIFAFRVLDVFFVEGPKVLFQVGLAILRINGEELLDAADDGAFISVLKSYFARLDESAHPRSENPKLRAVTRFQ
ELMVVAFKEFAAITHGTVTDLRLRNKDAVLSNIENFAKRTAIRNLGPDSKLLSTDELGALYDRFYSVLYERQQRE
HVLQEEQRRRKSSSSPYGNARRRASAVFGPAASSTGGGRGGGAQSHEVVEKGRVALGASTSLMDYDAFREFLAGM
ARWAIADSPGHSRRETGGGGGGLDVVDKPYHSARRAPDMASSPWGAGPTPAEHDFLRRLYGKWDVDGNSTLTLQN
VVTGLAGIKGRNDIMGTITYFFELYDDDGDGRVDREGILRISEALLFLSRRGLEGAPASSSSTTTSSLNGGGGGD
DARGNGGGAITNERFLGSVSAFIRRCFEYADPDHPQNKDREDETSSRRQDEAEVSADAFAVGDDEDEEEEDLLVL
ESKDEGKRGEQKDKTKEVDKAASDKETQGRRTSRAKSESANAALDPAHPLHMTLPTFRMVVLADELLEQFFESCF
PSSFRVVEGPRLRRPVTAVGRRRRGGPPGAGRGLRGVLDNIVTDGMRVATEVRRRMEEAQRELEKEAVPRPAKGS
GEADDDDDEDDDDDEVGVAVGARTGAPQDMERRSVMSTDRDLLDGLDAGAGGEEAETQTGV*
Coding >Ophcf2|00891
ATGTTCTCCAACCTGACCAACATCGTCCACCGCGCGCAGCAGCTCATCGATCCGACCCAGGGCCTAAACCTCTCC
AACTCGGACCGGAACCCGTCCAAGGCGTCGCTCTTCCAAAGCCAGTTTCGCCTACCGCCCTCGCAGACGCCCCTG
TGCGAGATCAACGCAGAGCTCACCATCCCGCCCTCCAACGCCACGCGCGGTGACCGAGACCGTGGATGGCATTAT
GCCGGCAAGCTGCACCTGTCCGAGTCCTACATGTGTTTCTCCACTACGCCCACCAGCTTCCTGCAGTCGGCCAGC
ACCTCGACATCGTCTGCATTTACCGGTCAGACGCACGGCGCCGGGCCCAGCGGCAACGGCTTCACCTTTCCCCTG
TGTGCTATCCGCCGCGTCGAGAGGCTGAATAGCCAAAACTTTCAGTTTGCCCTTGCCATCACCACCTGGAACGGT
CTCTTGGCCGTCGAAGACGACAAGGACGCCGACAAGGATCACGCACGGGAGCAGCGCATCACCCTCCATCTAGCC
GGATCGCGTCTCGCCTGCGAAAAGTTCTGCGACGGTCTGAAGCGTGGTCTTCGTGCCGGCGTCGGCAGCCTCGCC
AAGCTGCGCGGCGTCGTGGCCGAGTGCTACTCGCAGCATCTCCTCCGGCCTGACGATCGCAAGACGGCCGCTCCT
CCCGATGCCGGTCTCGGCATGCTCTTCCGCTATCCTGGCGATGCCAAGAAGCTGCGCGACCGGGCCAAGATGCGC
CTCTGGGCCGAGTACCTGCGCGACAACGGCCGCAACGTCACCCTCATCCGTCAGCCTACCTTCCACAAGCTCATC
CGCGTCGGCCTTCCCAACCGGCTCCGTGGAGAGATGTGGGAGCTCACGTCCGGCTCGCTCTACCTGCGGCTCGAG
AAGCCGACGCTCTACGCCGACACGCTCCAAAAGTTTCACGGTCAGGAGTCGCTCGCCATCGACGAGATCGAAAAG
GACCTCAACCGCAGCCTGCCCGAGTATCCGGGCTTCCAGAGTCAGGACGGCATCGGCCGCCTGCGCCGCGTGCTG
ACGGCTTACAGCTGGCTCAACGCCGACGTCGGCTACTGCCAGGCTATGAACATCGTCGTAGCCGCCTTGCTCATC
TACATGTCCGAGTCTCAGGCCTTCTTCCTCCTCTCGGCTCTGTGCGACCGCCTCGTGCCGGGCTACTACTCTACC
ACCATGTACGGCACCCTGCTCGATCAAAAGGTGTTCGAGTCTCTTGTCGAGCGCACCATGCCCGTCCTGTGGGAT
CACCTGGTCAAGAGCGACGTTCAGCTTTCCGTCGTCTCCCTGCCCTGGTTCCTGTCGCTCTACGTCAACTCGATG
CCCCTAATCTTCGCCTTCCGCGTCCTCGACGTCTTCTTCGTCGAGGGGCCCAAGGTTCTCTTTCAGGTCGGACTC
GCCATTCTGCGCATTAATGGCGAGGAGCTGCTCGACGCAGCCGACGACGGCGCCTTTATTTCCGTTCTGAAATCA
TACTTTGCCCGCCTCGACGAGTCGGCCCATCCGCGATCCGAGAATCCCAAGCTGCGGGCCGTCACTCGTTTCCAG
GAGCTCATGGTCGTCGCCTTCAAAGAGTTTGCCGCCATCACACACGGCACCGTCACCGACCTGCGCCTTCGCAAC
AAGGACGCCGTCCTCAGCAATATTGAGAACTTTGCCAAGCGCACCGCCATCCGCAACCTTGGCCCGGACAGCAAG
CTGCTGAGCACCGACGAGCTGGGCGCCCTCTACGACCGCTTCTACAGCGTCCTCTACGAGCGTCAGCAGCGCGAG
CACGTCCTGCAGGAGGAGCAGCGCCGCCGCAAGTCGTCATCGTCGCCGTACGGTAACGCTAGGAGGCGCGCCTCG
GCCGTCTTTGGCCCCGCGGCGTCCTCCACCGGCGGCGGACGAGGGGGCGGTGCTCAGAGTCACGAGGTGGTGGAA
AAGGGCCGGGTGGCGCTGGGGGCGAGCACCAGCCTCATGGACTACGACGCCTTCCGCGAGTTCCTCGCCGGCATG
GCCAGGTGGGCCATCGCCGACTCGCCCGGCCACTCCAGGCGCGAGACGGGCGGCGGCGGCGGCGGCCTCGACGTC
GTCGACAAGCCCTATCACAGCGCCCGGAGGGCCCCGGATATGGCGTCTTCGCCCTGGGGCGCCGGACCGACACCG
GCCGAGCACGATTTCCTGCGTCGCCTGTACGGCAAGTGGGACGTTGACGGCAACTCGACGCTGACGCTGCAGAAC
GTCGTGACGGGTCTGGCCGGCATCAAGGGGAGGAACGACATCATGGGCACCATCACCTACTTCTTCGAGCTCTAC
GACGACGACGGCGACGGCCGGGTCGACCGCGAGGGCATTCTACGCATCTCCGAAGCGCTGCTGTTCCTGTCGCGG
CGCGGCCTCGAAGGCGCTCCCGCATCGTCGTCGTCAACGACTACGTCATCACTCAACGGCGGCGGCGGCGGCGAC
GATGCTCGCGGCAATGGTGGAGGTGCCATCACCAACGAGCGTTTCCTCGGCAGCGTGAGCGCCTTCATCCGCCGC
TGCTTCGAGTACGCCGACCCGGACCATCCGCAGAACAAGGACAGGGAGGACGAGACGTCGTCCCGGCGGCAGGAC
GAGGCTGAGGTGAGCGCGGACGCGTTTGCCGTCGGCGACGACGAGGACGAGGAAGAAGAGGACCTGCTCGTGCTC
GAATCCAAAGACGAGGGGAAGCGAGGAGAGCAGAAGGACAAGACGAAGGAGGTCGACAAGGCGGCGTCGGATAAA
GAGACGCAAGGTCGCCGGACGTCGAGAGCCAAGTCGGAGTCGGCCAACGCGGCGCTGGATCCGGCGCATCCACTG
CACATGACGCTACCTACGTTCCGGATGGTGGTGTTGGCGGACGAGCTGCTGGAGCAGTTCTTCGAGTCGTGCTTC
CCGTCCTCGTTCCGGGTGGTGGAAGGCCCTCGGCTTCGGAGGCCGGTCACCGCAGTCGGGCGGAGGCGGCGGGGC
GGGCCTCCCGGGGCGGGGAGGGGCCTGCGCGGGGTGCTGGACAACATCGTCACGGACGGCATGCGGGTGGCGACG
GAGGTGCGGAGGCGGATGGAGGAGGCGCAGAGAGAGCTGGAGAAGGAGGCCGTACCCAGACCGGCCAAGGGGTCG
GGAGAAGCCGACGACGACGATGACGAAGACGACGACGACGACGAGGTGGGCGTTGCCGTCGGGGCCAGGACGGGC
GCTCCGCAGGATATGGAGCGGAGGTCGGTGATGAGCACGGACCGGGACTTGCTGGACGGTCTAGACGCCGGGGCC
GGGGGAGAAGAGGCCGAGACGCAGACGGGGGTTTGA
Transcript >Ophcf2|00891
ATGTTCTCCAACCTGACCAACATCGTCCACCGCGCGCAGCAGCTCATCGATCCGACCCAGGGCCTAAACCTCTCC
AACTCGGACCGGAACCCGTCCAAGGCGTCGCTCTTCCAAAGCCAGTTTCGCCTACCGCCCTCGCAGACGCCCCTG
TGCGAGATCAACGCAGAGCTCACCATCCCGCCCTCCAACGCCACGCGCGGTGACCGAGACCGTGGATGGCATTAT
GCCGGCAAGCTGCACCTGTCCGAGTCCTACATGTGTTTCTCCACTACGCCCACCAGCTTCCTGCAGTCGGCCAGC
ACCTCGACATCGTCTGCATTTACCGGTCAGACGCACGGCGCCGGGCCCAGCGGCAACGGCTTCACCTTTCCCCTG
TGTGCTATCCGCCGCGTCGAGAGGCTGAATAGCCAAAACTTTCAGTTTGCCCTTGCCATCACCACCTGGAACGGT
CTCTTGGCCGTCGAAGACGACAAGGACGCCGACAAGGATCACGCACGGGAGCAGCGCATCACCCTCCATCTAGCC
GGATCGCGTCTCGCCTGCGAAAAGTTCTGCGACGGTCTGAAGCGTGGTCTTCGTGCCGGCGTCGGCAGCCTCGCC
AAGCTGCGCGGCGTCGTGGCCGAGTGCTACTCGCAGCATCTCCTCCGGCCTGACGATCGCAAGACGGCCGCTCCT
CCCGATGCCGGTCTCGGCATGCTCTTCCGCTATCCTGGCGATGCCAAGAAGCTGCGCGACCGGGCCAAGATGCGC
CTCTGGGCCGAGTACCTGCGCGACAACGGCCGCAACGTCACCCTCATCCGTCAGCCTACCTTCCACAAGCTCATC
CGCGTCGGCCTTCCCAACCGGCTCCGTGGAGAGATGTGGGAGCTCACGTCCGGCTCGCTCTACCTGCGGCTCGAG
AAGCCGACGCTCTACGCCGACACGCTCCAAAAGTTTCACGGTCAGGAGTCGCTCGCCATCGACGAGATCGAAAAG
GACCTCAACCGCAGCCTGCCCGAGTATCCGGGCTTCCAGAGTCAGGACGGCATCGGCCGCCTGCGCCGCGTGCTG
ACGGCTTACAGCTGGCTCAACGCCGACGTCGGCTACTGCCAGGCTATGAACATCGTCGTAGCCGCCTTGCTCATC
TACATGTCCGAGTCTCAGGCCTTCTTCCTCCTCTCGGCTCTGTGCGACCGCCTCGTGCCGGGCTACTACTCTACC
ACCATGTACGGCACCCTGCTCGATCAAAAGGTGTTCGAGTCTCTTGTCGAGCGCACCATGCCCGTCCTGTGGGAT
CACCTGGTCAAGAGCGACGTTCAGCTTTCCGTCGTCTCCCTGCCCTGGTTCCTGTCGCTCTACGTCAACTCGATG
CCCCTAATCTTCGCCTTCCGCGTCCTCGACGTCTTCTTCGTCGAGGGGCCCAAGGTTCTCTTTCAGGTCGGACTC
GCCATTCTGCGCATTAATGGCGAGGAGCTGCTCGACGCAGCCGACGACGGCGCCTTTATTTCCGTTCTGAAATCA
TACTTTGCCCGCCTCGACGAGTCGGCCCATCCGCGATCCGAGAATCCCAAGCTGCGGGCCGTCACTCGTTTCCAG
GAGCTCATGGTCGTCGCCTTCAAAGAGTTTGCCGCCATCACACACGGCACCGTCACCGACCTGCGCCTTCGCAAC
AAGGACGCCGTCCTCAGCAATATTGAGAACTTTGCCAAGCGCACCGCCATCCGCAACCTTGGCCCGGACAGCAAG
CTGCTGAGCACCGACGAGCTGGGCGCCCTCTACGACCGCTTCTACAGCGTCCTCTACGAGCGTCAGCAGCGCGAG
CACGTCCTGCAGGAGGAGCAGCGCCGCCGCAAGTCGTCATCGTCGCCGTACGGTAACGCTAGGAGGCGCGCCTCG
GCCGTCTTTGGCCCCGCGGCGTCCTCCACCGGCGGCGGACGAGGGGGCGGTGCTCAGAGTCACGAGGTGGTGGAA
AAGGGCCGGGTGGCGCTGGGGGCGAGCACCAGCCTCATGGACTACGACGCCTTCCGCGAGTTCCTCGCCGGCATG
GCCAGGTGGGCCATCGCCGACTCGCCCGGCCACTCCAGGCGCGAGACGGGCGGCGGCGGCGGCGGCCTCGACGTC
GTCGACAAGCCCTATCACAGCGCCCGGAGGGCCCCGGATATGGCGTCTTCGCCCTGGGGCGCCGGACCGACACCG
GCCGAGCACGATTTCCTGCGTCGCCTGTACGGCAAGTGGGACGTTGACGGCAACTCGACGCTGACGCTGCAGAAC
GTCGTGACGGGTCTGGCCGGCATCAAGGGGAGGAACGACATCATGGGCACCATCACCTACTTCTTCGAGCTCTAC
GACGACGACGGCGACGGCCGGGTCGACCGCGAGGGCATTCTACGCATCTCCGAAGCGCTGCTGTTCCTGTCGCGG
CGCGGCCTCGAAGGCGCTCCCGCATCGTCGTCGTCAACGACTACGTCATCACTCAACGGCGGCGGCGGCGGCGAC
GATGCTCGCGGCAATGGTGGAGGTGCCATCACCAACGAGCGTTTCCTCGGCAGCGTGAGCGCCTTCATCCGCCGC
TGCTTCGAGTACGCCGACCCGGACCATCCGCAGAACAAGGACAGGGAGGACGAGACGTCGTCCCGGCGGCAGGAC
GAGGCTGAGGTGAGCGCGGACGCGTTTGCCGTCGGCGACGACGAGGACGAGGAAGAAGAGGACCTGCTCGTGCTC
GAATCCAAAGACGAGGGGAAGCGAGGAGAGCAGAAGGACAAGACGAAGGAGGTCGACAAGGCGGCGTCGGATAAA
GAGACGCAAGGTCGCCGGACGTCGAGAGCCAAGTCGGAGTCGGCCAACGCGGCGCTGGATCCGGCGCATCCACTG
CACATGACGCTACCTACGTTCCGGATGGTGGTGTTGGCGGACGAGCTGCTGGAGCAGTTCTTCGAGTCGTGCTTC
CCGTCCTCGTTCCGGGTGGTGGAAGGCCCTCGGCTTCGGAGGCCGGTCACCGCAGTCGGGCGGAGGCGGCGGGGC
GGGCCTCCCGGGGCGGGGAGGGGCCTGCGCGGGGTGCTGGACAACATCGTCACGGACGGCATGCGGGTGGCGACG
GAGGTGCGGAGGCGGATGGAGGAGGCGCAGAGAGAGCTGGAGAAGGAGGCCGTACCCAGACCGGCCAAGGGGTCG
GGAGAAGCCGACGACGACGATGACGAAGACGACGACGACGACGAGGTGGGCGTTGCCGTCGGGGCCAGGACGGGC
GCTCCGCAGGATATGGAGCGGAGGTCGGTGATGAGCACGGACCGGGACTTGCTGGACGGTCTAGACGCCGGGGCC
GGGGGAGAAGAGGCCGAGACGCAGACGGGGGTTTGA
Gene >Ophcf2|00891
ATGTTCTCCAACCTGACCAACATCGTCCACCGCGCGCAGCAGCTCATCGATCCGACCCAGGGCCTAAACCTCTCC
AACTCGGACCGGAACCCGTCCAAGGCGTCGCTCTTCCAAAGCCAGTTTCGCCTACCGCCCTCGCAGACGCCCCTG
TGCGAGATCAACGCAGAGCTCACCATCCCGCCCTCCAACGCCACGCGCGGTGACCGAGACCGTGGATGGCATTAT
GCCGGCAAGCTGCACCTGTCCGAGTCCTACATGTGTTTCTCCACTACGCCCACCAGCTTCCTGCAGTCGGCCAGC
ACCTCGACATCGTCTGCATTTACCGGTCAGACGCACGGCGCCGGGCCCAGCGGCAACGGCTTCACCTTTCCCCTG
TGTGCTATCCGCCGCGTCGAGAGGCTGAATAGCCAAAACTTTCAGGCAAAGACTTCGTTCAAGACGTCGGGAGAC
GTGGGGCTGACTTTGGCTTTCCAGTTTGCCCTTGCCATCACCACCTGGAACGGTCTCTTGGCCGTCGAAGACGAC
AAGGACGCCGACAAGGATCACGCACGGGAGCAGCGCATCACCCTCCATCTAGCCGGATCGCGTCTCGCCTGCGAA
AAGTTCTGCGACGGTCTGAAGCGTGGTCTTCGTGCCGGCGTCGGCAGCCTCGCCAAGCTGCGCGGCGTCGTGGCC
GAGTGCTACTCGCAGCATCTCCTCCGGCCTGACGATCGCAAGACGGCCGCTCCTCCCGATGCCGGTCTCGGCATG
CTCTTCCGCTATCCTGGCGATGCCAAGAAGCTGCGCGACCGGGCCAAGATGCGCCTCTGGGCCGAGTACCTGCGC
GACAACGGCCGCAACGTCACCCTCATCCGTCAGCCTACCTTCCACAAGCTCATCCGCGTCGGCCTTCCCAACCGG
CTCCGTGGAGAGATGTGGGAGCTCACGTCCGGCTCGCTCTACCTGCGGCTCGAGAAGCCGACGCTCTACGCCGAC
ACGCTCCAAAAGTTTCACGGTCAGGAGTCGCTCGCCATCGACGAGATCGAAAAGGACCTCAACCGCAGCCTGCCC
GAGTATCCGGGCTTCCAGAGTCAGGACGGCATCGGCCGCCTGCGCCGCGTGCTGACGGCTTACAGCTGGCTCAAC
GCCGACGTCGGCTACTGCCAGGCTATGAACATCGTCGTAGCCGCCTTGCTCATCTACATGTCCGAGTCTCAGGCC
TTCTTCCTCCTCTCGGCTCTGTGCGACCGCCTCGTGCCGGGCTACTACTCTACCACCATGTACGGCACCCTGCTC
GATCAAAAGGTGTTCGAGTCTCTTGTCGAGCGCACCATGCCCGTCCTGTGGGATCACCTGGTCAAGAGCGACGTT
CAGCTTTCCGTCGTCTCCCTGCCCTGGTTCCTGTCGCTCTACGTCAACTCGATGCCCCTAATCTTCGCCTTCCGC
GTCCTCGACGTCTTCTTCGTCGAGGGGCCCAAGGTTCTCTTTCAGGTCGGACTCGCCATTCTGCGCATTAATGGC
GAGGAGCTGCTCGACGCAGCCGACGACGGCGCCTTTATTTCCGTTCTGAAATCATACTTTGCCCGCCTCGACGAG
TCGGCCCATCCGCGATCCGAGAATCCCAAGCTGCGGGCCGTCACTCGTTTCCAGGAGCTCATGGTCGTCGCCTTC
AAAGAGTTTGCCGCCATCACACACGGCACCGTCACCGACCTGCGCCTTCGCAACAAGGACGCCGTCCTCAGCAAT
ATTGAGAACTTTGCCAAGCGCACCGCCATCCGCAACCTTGGCCCGGACAGCAAGCTGCTGAGCACCGACGAGCTG
GGCGCCCTCTACGACCGCTTCTACAGCGTCCTCTACGAGCGTCAGCAGCGCGAGCACGTCCTGCAGGAGGAGCAG
CGCCGCCGCAAGTCGTCATCGTCGCCGTACGGTAACGCTAGGAGGCGCGCCTCGGCCGTCTTTGGCCCCGCGGCG
TCCTCCACCGGCGGCGGACGAGGGGGCGGTGCTCAGAGTCACGAGGTGGTGGAAAAGGGCCGGGTGGCGCTGGGG
GCGAGCACCAGCCTCATGGACTACGACGCCTTCCGCGAGTTCCTCGCCGGCATGGCCAGGTGGGCCATCGCCGAC
TCGCCCGGCCACTCCAGGCGCGAGACGGGCGGCGGCGGCGGCGGCCTCGACGTCGTCGACAAGCCCTATCACAGC
GCCCGGAGGGCCCCGGATATGGCGTCTTCGCCCTGGGGCGCCGGACCGACACCGGCCGAGCACGATTTCCTGCGT
CGCCTGTACGGCAAGTGGGACGTTGACGGCAACTCGACGCTGACGCTGCAGAACGTCGTGACGGGTCTGGCCGGC
ATCAAGGGGAGGAACGACATCATGGGCACCATCACCTACTTCTTCGAGCTCTACGACGACGACGGCGACGGCCGG
GTCGACCGCGAGGGCATTCTACGCATCTCCGAAGCGCTGCTGTTCCTGTCGCGGCGCGGCCTCGAAGGCGCTCCC
GCATCGTCGTCGTCAACGACTACGTCATCACTCAACGGCGGCGGCGGCGGCGACGATGCTCGCGGCAATGGTGGA
GGTGCCATCACCAACGAGCGTTTCCTCGGCAGCGTGAGCGCCTTCATCCGCCGCTGCTTCGAGTACGCCGACCCG
GACCATCCGCAGAACAAGGACAGGGAGGACGAGACGTCGTCCCGGCGGCAGGACGAGGCTGAGGTGAGCGCGGAC
GCGTTTGCCGTCGGCGACGACGAGGACGAGGAAGAAGAGGACCTGCTCGTGCTCGAATCCAAAGACGAGGGGAAG
CGAGGAGAGCAGAAGGACAAGACGAAGGAGGTCGACAAGGCGGCGTCGGATAAAGAGACGCAAGGTCGCCGGACG
TCGAGAGCCAAGTCGGAGTCGGCCAACGCGGCGCTGGATCCGGCGCATCCACTGCACATGACGCTACCTACGTTC
CGGATGGTGGTGTTGGCGGACGAGCTGCTGGAGCAGTTCTTCGAGTCGTGCTTCCCGTCCTCGTTCCGGGTGGTG
GAAGGCGTGCGAGGAGGTTCGGCGACGCCGACGAGCTCTTCGCTGACGACTTTCTCCAGCCTCGGCTTCGGAGGC
CGGTCACCGCAGTCGGGCGGAGGCGGCGGGGCGGGCCTCCCGGGGCGGGGAGGGGCCTGCGCGGGGTGCTGGACA
ACATCGTCACGGACGGCATGCGGGTGGCGACGGAGGTGCGGAGGCGGATGGAGGAGGCGCAGAGAGAGCTGGAGA
AGGAGGCCGTACCCAGACCGGCCAAGGGGTCGGGAGAAGCCGACGACGACGATGACGAAGACGACGACGACGACG
AGGTGGGCGTTGCCGTCGGGGCCAGGACGGGCGCTCCGCAGGATATGGAGCGGAGGTCGGTGATGAGCACGGACC
GGGACTTGCTGGACGGTCTAGACGCCGGGGCCGGGGGAGAAGAGGCCGAGACGCAGACGGGGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail