Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00882
Gene name
Locationscaffold_01:3373356..3376635
Strand-
Gene length (bp)3279
Transcript length (bp)3162
Coding sequence length (bp)3162
Protein length (aa) 1054

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11923 NFACT-C NFACT protein C-terminal domain 2.1E-41 915 1022
PF05670 NFACT-R_1 NFACT protein RNA binding domain 5.3E-31 547 659
PF05833 NFACT_N NFACT N-terminal and middle domains 2.3E-26 7 522

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5481 0.5506 0.0797 0.053 0.1776 0.0033 0.0549 0.0192 0.0489 0.0056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4336
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7542
Ophiocordyceps australis map64 (Brazil) OphauB2|3058
Ophiocordyceps camponoti-floridani Ophcf2|00882 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5679
Ophiocordyceps kimflemingae Ophio5|4287
Ophiocordyceps subramaniannii Hirsu2|891

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00882
MKQRFSSLDVKVIAHELNQHLPTLRVSNIYDLSSKILLFKFAKPDCKRQLIIDSGFRCHLTEFARTTAAAPSVFV
TQLRKFLKTRRVTSVVQIGTDRVLEFQFSDGQYRLFLEFFASGNIILTNADLDILTIARNVPEGAGQEPQRVGLK
YLLENRQNYQGIPALTTQRVRLALESAVQTATAASDAAEKPKGKSVASLRKSLAVSITELPPIIVHHTLQSNDFD
LTAKPEDILQNDALLEKLVRLLSEAREKIQEITSASVCTGYIFAKRKDKQAADSDAPIRREDLLYDDFHPFIPTM
MGNDSAIKVLEFSGYNKTVDEFFSSLEGQKLESRLTQREETAKRKLEAARKDQTKRLEGLQEAQSLNFRRAAAIE
ANVERVQEAMDAINGLLAQGMDWVDIGKLVERERKKKNAVAEIIVLPLNLGENIMTLKLAEAKTEADEEPDPFET
DDEGSSDGEEAASAPSKAKQAEKYLTVDINLGISPWSNAREYYDQRRSAAAKEEKTQLQAAKAMKNAEQKINEDL
KKGLKQEKALLQPIRQQMWFEKFTWFVSSDGYLVLGGKDTGQNEMLYRKYLRKGDVYCHADLRGAATVIIKNDPK
TPEAPIPPATLSQAGSLAVCSSEAWDSKAGMGAWWVNADQVSKSAATGDFLSEGNFTVQGKKNHLAPAQLLLGFG
IMFRISDASKDRHVKHRLHDGDAAGADETEQEKPNPLSGGEVDGAAEDVAEQEDDDSLSDVQSEEDESRHESGRD
NPLQTQGQGGGDDDDAATDRNEKSELDVANLAIEADAEQEQGADEAGDQGQDRSELAMEAEAASTTTSTWRPSAK
APPKRGQKGKAKKMANKYKDQDEEDRAAAEALIGAAAGKQKAEAEAKARAEAKAQLEAAKERRRAQHQRQQKETA
AHEQARRNMMESDSAEATTDLDALVGTPLPGDEVLEAMAVCAPWIALGKFKYKAKMQPGATKKGKAVREVLDRWR
ADSSKKGAVDEAARDVEKMWPREVELIKGLKTEEVVNVVPVGKVKVMMAGGGGKGKAGGGGGAKGQSKKGRGGKG
SKR*
Coding >Ophcf2|00882
ATGAAGCAACGGTTCTCGTCACTGGATGTCAAGGTTATCGCCCACGAGCTCAACCAGCACCTGCCAACGCTGCGA
GTCTCCAACATCTACGACCTTTCCTCCAAGATCCTACTCTTCAAGTTCGCCAAGCCCGACTGCAAGAGGCAACTC
ATCATCGATTCTGGCTTTCGATGCCATCTGACCGAGTTTGCCCGCACCACCGCCGCCGCACCCTCCGTCTTCGTC
ACTCAGTTGCGCAAGTTTCTCAAGACGAGGCGCGTCACGTCCGTGGTCCAGATCGGGACGGATAGAGTGCTCGAA
TTTCAGTTCAGCGACGGACAGTATCGACTGTTTCTAGAGTTCTTTGCTAGCGGAAACATCATCCTTACAAATGCC
GACCTGGACATTCTAACCATCGCGCGCAATGTTCCTGAAGGTGCCGGCCAGGAGCCGCAAAGAGTCGGTCTCAAA
TATTTGCTGGAAAACCGGCAAAACTACCAGGGCATTCCCGCCTTGACTACGCAGCGAGTCCGCTTGGCTTTGGAG
TCTGCCGTTCAAACGGCTACTGCTGCTTCCGATGCGGCGGAGAAACCAAAAGGAAAGTCGGTTGCCAGTTTGAGG
AAGAGCCTCGCCGTATCAATCACGGAGTTGCCTCCCATTATCGTCCATCACACCCTCCAATCTAACGACTTTGAC
CTGACGGCCAAGCCAGAGGATATATTGCAAAATGATGCGCTATTAGAGAAGCTGGTTCGACTCCTATCGGAAGCA
CGGGAAAAAATTCAGGAGATTACATCGGCTTCCGTCTGCACAGGGTACATCTTTGCGAAGCGCAAGGACAAGCAA
GCGGCCGATAGCGACGCTCCTATCAGAAGGGAAGACCTGCTCTATGATGATTTCCATCCTTTTATCCCGACCATG
ATGGGCAACGACTCTGCCATCAAGGTACTGGAGTTTTCTGGCTACAATAAGACGGTAGACGAGTTCTTCTCCTCA
TTGGAAGGCCAGAAACTCGAAAGCCGTCTAACCCAGCGGGAAGAAACGGCCAAGCGCAAGCTCGAGGCCGCCAGG
AAGGACCAGACCAAGCGTTTAGAGGGCCTCCAGGAAGCGCAGTCGTTGAATTTTCGACGAGCCGCCGCCATCGAG
GCCAATGTCGAGCGCGTACAAGAAGCCATGGACGCTATCAACGGCCTGCTGGCCCAAGGCATGGACTGGGTAGAC
ATTGGAAAACTGGTGGAGAGGGAACGGAAGAAGAAGAATGCCGTGGCCGAGATTATCGTGCTGCCGCTCAATCTT
GGAGAGAACATCATGACGCTCAAGCTAGCCGAGGCCAAAACCGAGGCCGACGAAGAACCAGACCCGTTCGAGACG
GACGACGAAGGTTCCTCCGACGGGGAGGAGGCTGCATCAGCTCCATCCAAAGCCAAGCAGGCCGAAAAGTACCTG
ACTGTCGATATCAACCTGGGCATCAGTCCCTGGAGCAACGCGAGAGAGTACTACGATCAAAGACGGTCGGCCGCG
GCCAAGGAGGAAAAGACGCAGCTGCAGGCGGCCAAGGCGATGAAGAATGCCGAGCAAAAGATCAACGAGGATCTC
AAGAAGGGGCTGAAGCAGGAAAAGGCGCTACTACAGCCCATCAGACAGCAGATGTGGTTCGAGAAGTTTACCTGG
TTCGTCTCGTCTGACGGCTACCTCGTCCTCGGCGGCAAGGACACGGGGCAGAACGAGATGCTGTACCGCAAGTAT
CTGCGGAAAGGCGACGTCTACTGTCACGCCGACTTACGTGGAGCGGCCACCGTCATCATCAAGAACGATCCGAAG
ACACCCGAGGCACCGATACCGCCCGCGACGCTGTCCCAGGCCGGCTCGCTCGCCGTCTGTTCGTCGGAGGCGTGG
GATTCCAAGGCCGGAATGGGTGCCTGGTGGGTGAACGCTGACCAAGTGTCCAAGTCGGCTGCCACGGGGGACTTC
CTGTCAGAGGGCAACTTTACGGTGCAGGGCAAGAAGAATCATCTGGCGCCGGCACAGCTCCTACTTGGCTTCGGC
ATCATGTTCAGGATCAGCGACGCGAGCAAGGACCGGCACGTCAAACACCGATTACACGATGGCGACGCAGCCGGA
GCGGATGAGACGGAGCAGGAAAAACCAAACCCCCTATCAGGAGGCGAGGTCGATGGAGCTGCTGAGGATGTGGCG
GAACAAGAAGATGACGACTCCTTGTCGGATGTACAGTCTGAAGAGGACGAAAGTCGGCATGAGTCTGGGCGTGAT
AACCCTCTGCAGACACAAGGCCAGGGAGGTGGCGATGATGACGATGCGGCTACGGATCGAAACGAAAAGTCGGAG
CTTGATGTGGCAAACCTGGCCATTGAAGCCGATGCCGAACAAGAGCAGGGCGCAGACGAGGCTGGGGATCAAGGC
CAGGATCGGTCCGAGCTGGCAATGGAAGCCGAAGCAGCATCGACAACTACGTCGACGTGGCGGCCCAGTGCCAAG
GCACCCCCCAAGCGTGGCCAGAAGGGCAAGGCGAAGAAGATGGCCAACAAGTACAAGGATCAAGACGAAGAGGAC
CGGGCCGCGGCCGAGGCGCTCATCGGGGCGGCGGCGGGCAAGCAAAAGGCCGAAGCGGAAGCCAAGGCACGGGCC
GAAGCCAAGGCGCAGCTCGAAGCAGCCAAGGAGCGGCGACGAGCTCAGCACCAGCGGCAGCAGAAGGAGACGGCG
GCTCACGAGCAGGCGCGGCGCAACATGATGGAATCGGACTCGGCCGAAGCGACGACGGATCTCGACGCGCTGGTG
GGCACGCCCTTGCCGGGAGACGAGGTGCTGGAGGCGATGGCTGTATGCGCGCCATGGATCGCGCTCGGCAAGTTC
AAGTACAAGGCCAAGATGCAGCCCGGGGCGACGAAGAAGGGCAAGGCCGTCAGGGAGGTGCTGGACCGCTGGCGG
GCCGATTCGAGCAAGAAGGGGGCCGTTGACGAGGCAGCGAGGGACGTGGAGAAGATGTGGCCTCGAGAGGTGGAG
CTCATAAAGGGGCTCAAGACGGAGGAGGTCGTCAACGTGGTGCCCGTGGGCAAGGTCAAGGTCATGATGGCGGGC
GGAGGCGGCAAGGGCAAGGCTGGTGGTGGTGGTGGTGCTAAGGGACAAAGTAAAAAAGGCCGTGGAGGGAAGGGT
TCCAAGAGGTGA
Transcript >Ophcf2|00882
ATGAAGCAACGGTTCTCGTCACTGGATGTCAAGGTTATCGCCCACGAGCTCAACCAGCACCTGCCAACGCTGCGA
GTCTCCAACATCTACGACCTTTCCTCCAAGATCCTACTCTTCAAGTTCGCCAAGCCCGACTGCAAGAGGCAACTC
ATCATCGATTCTGGCTTTCGATGCCATCTGACCGAGTTTGCCCGCACCACCGCCGCCGCACCCTCCGTCTTCGTC
ACTCAGTTGCGCAAGTTTCTCAAGACGAGGCGCGTCACGTCCGTGGTCCAGATCGGGACGGATAGAGTGCTCGAA
TTTCAGTTCAGCGACGGACAGTATCGACTGTTTCTAGAGTTCTTTGCTAGCGGAAACATCATCCTTACAAATGCC
GACCTGGACATTCTAACCATCGCGCGCAATGTTCCTGAAGGTGCCGGCCAGGAGCCGCAAAGAGTCGGTCTCAAA
TATTTGCTGGAAAACCGGCAAAACTACCAGGGCATTCCCGCCTTGACTACGCAGCGAGTCCGCTTGGCTTTGGAG
TCTGCCGTTCAAACGGCTACTGCTGCTTCCGATGCGGCGGAGAAACCAAAAGGAAAGTCGGTTGCCAGTTTGAGG
AAGAGCCTCGCCGTATCAATCACGGAGTTGCCTCCCATTATCGTCCATCACACCCTCCAATCTAACGACTTTGAC
CTGACGGCCAAGCCAGAGGATATATTGCAAAATGATGCGCTATTAGAGAAGCTGGTTCGACTCCTATCGGAAGCA
CGGGAAAAAATTCAGGAGATTACATCGGCTTCCGTCTGCACAGGGTACATCTTTGCGAAGCGCAAGGACAAGCAA
GCGGCCGATAGCGACGCTCCTATCAGAAGGGAAGACCTGCTCTATGATGATTTCCATCCTTTTATCCCGACCATG
ATGGGCAACGACTCTGCCATCAAGGTACTGGAGTTTTCTGGCTACAATAAGACGGTAGACGAGTTCTTCTCCTCA
TTGGAAGGCCAGAAACTCGAAAGCCGTCTAACCCAGCGGGAAGAAACGGCCAAGCGCAAGCTCGAGGCCGCCAGG
AAGGACCAGACCAAGCGTTTAGAGGGCCTCCAGGAAGCGCAGTCGTTGAATTTTCGACGAGCCGCCGCCATCGAG
GCCAATGTCGAGCGCGTACAAGAAGCCATGGACGCTATCAACGGCCTGCTGGCCCAAGGCATGGACTGGGTAGAC
ATTGGAAAACTGGTGGAGAGGGAACGGAAGAAGAAGAATGCCGTGGCCGAGATTATCGTGCTGCCGCTCAATCTT
GGAGAGAACATCATGACGCTCAAGCTAGCCGAGGCCAAAACCGAGGCCGACGAAGAACCAGACCCGTTCGAGACG
GACGACGAAGGTTCCTCCGACGGGGAGGAGGCTGCATCAGCTCCATCCAAAGCCAAGCAGGCCGAAAAGTACCTG
ACTGTCGATATCAACCTGGGCATCAGTCCCTGGAGCAACGCGAGAGAGTACTACGATCAAAGACGGTCGGCCGCG
GCCAAGGAGGAAAAGACGCAGCTGCAGGCGGCCAAGGCGATGAAGAATGCCGAGCAAAAGATCAACGAGGATCTC
AAGAAGGGGCTGAAGCAGGAAAAGGCGCTACTACAGCCCATCAGACAGCAGATGTGGTTCGAGAAGTTTACCTGG
TTCGTCTCGTCTGACGGCTACCTCGTCCTCGGCGGCAAGGACACGGGGCAGAACGAGATGCTGTACCGCAAGTAT
CTGCGGAAAGGCGACGTCTACTGTCACGCCGACTTACGTGGAGCGGCCACCGTCATCATCAAGAACGATCCGAAG
ACACCCGAGGCACCGATACCGCCCGCGACGCTGTCCCAGGCCGGCTCGCTCGCCGTCTGTTCGTCGGAGGCGTGG
GATTCCAAGGCCGGAATGGGTGCCTGGTGGGTGAACGCTGACCAAGTGTCCAAGTCGGCTGCCACGGGGGACTTC
CTGTCAGAGGGCAACTTTACGGTGCAGGGCAAGAAGAATCATCTGGCGCCGGCACAGCTCCTACTTGGCTTCGGC
ATCATGTTCAGGATCAGCGACGCGAGCAAGGACCGGCACGTCAAACACCGATTACACGATGGCGACGCAGCCGGA
GCGGATGAGACGGAGCAGGAAAAACCAAACCCCCTATCAGGAGGCGAGGTCGATGGAGCTGCTGAGGATGTGGCG
GAACAAGAAGATGACGACTCCTTGTCGGATGTACAGTCTGAAGAGGACGAAAGTCGGCATGAGTCTGGGCGTGAT
AACCCTCTGCAGACACAAGGCCAGGGAGGTGGCGATGATGACGATGCGGCTACGGATCGAAACGAAAAGTCGGAG
CTTGATGTGGCAAACCTGGCCATTGAAGCCGATGCCGAACAAGAGCAGGGCGCAGACGAGGCTGGGGATCAAGGC
CAGGATCGGTCCGAGCTGGCAATGGAAGCCGAAGCAGCATCGACAACTACGTCGACGTGGCGGCCCAGTGCCAAG
GCACCCCCCAAGCGTGGCCAGAAGGGCAAGGCGAAGAAGATGGCCAACAAGTACAAGGATCAAGACGAAGAGGAC
CGGGCCGCGGCCGAGGCGCTCATCGGGGCGGCGGCGGGCAAGCAAAAGGCCGAAGCGGAAGCCAAGGCACGGGCC
GAAGCCAAGGCGCAGCTCGAAGCAGCCAAGGAGCGGCGACGAGCTCAGCACCAGCGGCAGCAGAAGGAGACGGCG
GCTCACGAGCAGGCGCGGCGCAACATGATGGAATCGGACTCGGCCGAAGCGACGACGGATCTCGACGCGCTGGTG
GGCACGCCCTTGCCGGGAGACGAGGTGCTGGAGGCGATGGCTGTATGCGCGCCATGGATCGCGCTCGGCAAGTTC
AAGTACAAGGCCAAGATGCAGCCCGGGGCGACGAAGAAGGGCAAGGCCGTCAGGGAGGTGCTGGACCGCTGGCGG
GCCGATTCGAGCAAGAAGGGGGCCGTTGACGAGGCAGCGAGGGACGTGGAGAAGATGTGGCCTCGAGAGGTGGAG
CTCATAAAGGGGCTCAAGACGGAGGAGGTCGTCAACGTGGTGCCCGTGGGCAAGGTCAAGGTCATGATGGCGGGC
GGAGGCGGCAAGGGCAAGGCTGGTGGTGGTGGTGGTGCTAAGGGACAAAGTAAAAAAGGCCGTGGAGGGAAGGGT
TCCAAGAGGTGA
Gene >Ophcf2|00882
ATGAAGCAACGGTTCTCGTCACTGGATGTCAAGGTATTCGGCGTCACGACCGTCTTCATAACGTCACTGGCTGAC
GGCCCTCGCTTCCCTTCAGGTTATCGCCCACGAGCTCAACCAGCACCTGCCAACGCTGCGAGTCTCCAACATCTA
CGACCTTTCCTCCAAGATCCTACTCTTCAAGTTCGCCAAGCCCGACTGCAAGAGGCAACTCATCATCGATTCTGG
CTTTCGATGCCATCTGACCGAGTTTGCCCGCACCACCGCCGCCGCACCCTCCGTCTTCGTCACTCAGTTGCGCAA
GTTTCTCAAGACGAGGCGCGTCACGTCCGTGGTCCAGATCGGGACGGATAGAGTGCTCGAATTTCAGTTCAGCGA
CGGACAGTATCGACTGTTTCTAGAGTTCTTTGCTGTATGCAGTATCGTCCGGCTGGCAGCTGTCTGTTCCCAGGC
TGATGCGCATGACAGAGCGGAAACATCATCCTTACAAATGCCGACCTGGACATTCTAACCATCGCGCGCAATGTT
CCTGAAGGTGCCGGCCAGGAGCCGCAAAGAGTCGGTCTCAAATATTTGCTGGAAAACCGGCAAAACTACCAGGGC
ATTCCCGCCTTGACTACGCAGCGAGTCCGCTTGGCTTTGGAGTCTGCCGTTCAAACGGCTACTGCTGCTTCCGAT
GCGGCGGAGAAACCAAAAGGAAAGTCGGTTGCCAGTTTGAGGAAGAGCCTCGCCGTATCAATCACGGAGTTGCCT
CCCATTATCGTCCATCACACCCTCCAATCTAACGACTTTGACCTGACGGCCAAGCCAGAGGATATATTGCAAAAT
GATGCGCTATTAGAGAAGCTGGTTCGACTCCTATCGGAAGCACGGGAAAAAATTCAGGAGATTACATCGGCTTCC
GTCTGCACAGGGTACATCTTTGCGAAGCGCAAGGACAAGCAAGCGGCCGATAGCGACGCTCCTATCAGAAGGGAA
GACCTGCTCTATGATGATTTCCATCCTTTTATCCCGACCATGATGGGCAACGACTCTGCCATCAAGGTACTGGAG
TTTTCTGGCTACAATAAGACGGTAGACGAGTTCTTCTCCTCATTGGAAGGCCAGAAACTCGAAAGCCGTCTAACC
CAGCGGGAAGAAACGGCCAAGCGCAAGCTCGAGGCCGCCAGGAAGGACCAGACCAAGCGTTTAGAGGGCCTCCAG
GAAGCGCAGTCGTTGAATTTTCGACGAGCCGCCGCCATCGAGGCCAATGTCGAGCGCGTACAAGAAGCCATGGAC
GCTATCAACGGCCTGCTGGCCCAAGGCATGGACTGGGTAGACATTGGAAAACTGGTGGAGAGGGAACGGAAGAAG
AAGAATGCCGTGGCCGAGATTATCGTGCTGCCGCTCAATCTTGGAGAGAACATCATGACGCTCAAGCTAGCCGAG
GCCAAAACCGAGGCCGACGAAGAACCAGACCCGTTCGAGACGGACGACGAAGGTTCCTCCGACGGGGAGGAGGCT
GCATCAGCTCCATCCAAAGCCAAGCAGGCCGAAAAGTACCTGACTGTCGATATCAACCTGGGCATCAGTCCCTGG
AGCAACGCGAGAGAGTACTACGATCAAAGACGGTCGGCCGCGGCCAAGGAGGAAAAGACGCAGCTGCAGGCGGCC
AAGGCGATGAAGAATGCCGAGCAAAAGATCAACGAGGATCTCAAGAAGGGGCTGAAGCAGGAAAAGGCGCTACTA
CAGCCCATCAGACAGCAGATGTGGTTCGAGAAGTTTACCTGGTTCGTCTCGTCTGACGGCTACCTCGTCCTCGGC
GGCAAGGACACGGGGCAGAACGAGATGCTGTACCGCAAGTATCTGCGGAAAGGCGACGTCTACTGTCACGCCGAC
TTACGTGGAGCGGCCACCGTCATCATCAAGAACGATCCGAAGACACCCGAGGCACCGATACCGCCCGCGACGCTG
TCCCAGGCCGGCTCGCTCGCCGTCTGTTCGTCGGAGGCGTGGGATTCCAAGGCCGGAATGGGTGCCTGGTGGGTG
AACGCTGACCAAGTGTCCAAGTCGGCTGCCACGGGGGACTTCCTGTCAGAGGGCAACTTTACGGTGCAGGGCAAG
AAGAATCATCTGGCGCCGGCACAGCTCCTACTTGGCTTCGGCATCATGTTCAGGATCAGCGACGCGAGCAAGGAC
CGGCACGTCAAACACCGATTACACGATGGCGACGCAGCCGGAGCGGATGAGACGGAGCAGGAAAAACCAAACCCC
CTATCAGGAGGCGAGGTCGATGGAGCTGCTGAGGATGTGGCGGAACAAGAAGATGACGACTCCTTGTCGGATGTA
CAGTCTGAAGAGGACGAAAGTCGGCATGAGTCTGGGCGTGATAACCCTCTGCAGACACAAGGCCAGGGAGGTGGC
GATGATGACGATGCGGCTACGGATCGAAACGAAAAGTCGGAGCTTGATGTGGCAAACCTGGCCATTGAAGCCGAT
GCCGAACAAGAGCAGGGCGCAGACGAGGCTGGGGATCAAGGCCAGGATCGGTCCGAGCTGGCAATGGAAGCCGAA
GCAGCATCGACAACTACGTCGACGTGGCGGCCCAGTGCCAAGGCACCCCCCAAGCGTGGCCAGAAGGGCAAGGCG
AAGAAGATGGCCAACAAGTACAAGGATCAAGACGAAGAGGACCGGGCCGCGGCCGAGGCGCTCATCGGGGCGGCG
GCGGGCAAGCAAAAGGCCGAAGCGGAAGCCAAGGCACGGGCCGAAGCCAAGGCGCAGCTCGAAGCAGCCAAGGAG
CGGCGACGAGCTCAGCACCAGCGGCAGCAGAAGGAGACGGCGGCTCACGAGCAGGCGCGGCGCAACATGATGGAA
TCGGACTCGGCCGAAGCGACGACGGATCTCGACGCGCTGGTGGGCACGCCCTTGCCGGGAGACGAGGTGCTGGAG
GCGATGGCTGTATGCGCGCCATGGATCGCGCTCGGCAAGTTCAAGTACAAGGCCAAGATGCAGCCCGGGGCGACG
AAGAAGGGCAAGGCCGTCAGGGAGGTGCTGGACCGCTGGCGGGCCGATTCGAGCAAGAAGGGGGCCGTTGACGAG
GCAGCGAGGGACGTGGAGAAGATGTGGCCTCGAGAGGTGGAGCTCATAAAGGGGCTCAAGACGGAGGAGGTCGTC
AACGTGGTGCCCGTGGGCAAGGTCAAGGTCATGATGGCGGGCGGAGGCGGCAAGGGCAAGGCTGGTGGTGGTGGT
GGTGCTAAGGGACAAAGTAAAAAAGGCCGTGGAGGGAAGGGTTCCAAGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail