Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00879
Gene name
Locationscaffold_01:3367546..3368979
Strand-
Gene length (bp)1433
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 9.1E-23 168 298
PF08241 Methyltransf_11 Methyltransferase domain 4.2E-13 189 278
PF13649 Methyltransf_25 Methyltransferase domain 7.4E-13 189 276
PF08242 Methyltransf_12 Methyltransferase domain 5.4E-09 189 278

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5967 0.408 0.0316 0.1428 0.2122 0.0087 0.3539 0.2257 0.3128 0.0147

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup116
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1824
Ophiocordyceps australis 1348a (Ghana) OphauG2|2470
Ophiocordyceps australis map64 (Brazil) OphauB2|3061
Ophiocordyceps australis map64 (Brazil) OphauB2|4472
Ophiocordyceps camponoti-floridani Ophcf2|00879 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06995
Ophiocordyceps camponoti-rufipedis Ophun1|5295
Ophiocordyceps camponoti-rufipedis Ophun1|6510
Ophiocordyceps kimflemingae Ophio5|4284
Ophiocordyceps kimflemingae Ophio5|5055
Ophiocordyceps kimflemingae Ophio5|6669
Ophiocordyceps subramaniannii Hirsu2|3221
Ophiocordyceps subramaniannii Hirsu2|38
Ophiocordyceps subramaniannii Hirsu2|7756

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00879
MDIREVQRDASQRDTLQRDTLQRDAVQRDAVQRDAAQPDGPQPDDPQQTLDHSKKLDPDDARFASPLTHPNGTSI
FPTLSASEQHLMAQEALEQAQEAIVLDEQVVRDDSDAGYSSDGFSSATTSAQSSVRDYLYENGRRYHRFREGSYN
FPNDDVEQEREDMKHAMVKLLCSQKLLFAPIGNNPQQMLDLGTGTGIWAIEVGDQYPSAHVLGVDLSPIQPDWLP
PNVRFLVDDVESTWLYPPNHFDYIHSRHTVMAVRDWRRLFRHAYQHLKPGGWIELQEIHHKPRSARPDGRPLSPD
HAVAQFWARVNEGLTGLGVDLDRATGGYLAQAMRDEGLVNITERVFHVPIGTWPKNKVLKTVGLYWRTILLDGLQ
AIALGPLTRGLHWDRQQVEMFLVDVRRAYHDNSALMYMPLHILYAQKPE*
Coding >Ophcf2|00879
ATGGACATCCGAGAGGTTCAGCGGGATGCTTCCCAGCGGGATACTCTCCAGCGGGATACTCTCCAGCGAGATGCC
GTCCAGCGAGATGCCGTCCAGCGAGATGCCGCTCAACCAGACGGACCCCAACCAGACGACCCCCAGCAGACCCTC
GACCACAGCAAGAAGCTCGACCCCGACGACGCCCGCTTCGCCTCGCCGCTGACGCACCCCAACGGCACTTCTATT
TTCCCCACGCTCTCCGCCTCGGAACAGCATCTCATGGCCCAAGAAGCCCTCGAGCAGGCCCAGGAGGCCATCGTC
CTCGACGAGCAGGTGGTACGCGATGATTCTGACGCTGGTTACAGCAGCGACGGCTTCAGCTCTGCCACTACGTCG
GCCCAGTCCTCGGTACGGGATTACCTCTACGAAAACGGCCGACGATATCACCGCTTCCGCGAGGGCTCCTACAAC
TTTCCCAACGACGACGTCGAGCAAGAGCGCGAAGATATGAAACACGCCATGGTCAAGCTCCTCTGCTCGCAGAAG
CTTCTCTTCGCTCCCATCGGCAACAATCCCCAGCAAATGCTCGATCTCGGCACCGGCACCGGCATATGGGCCATC
GAGGTGGGAGATCAGTACCCGAGCGCTCACGTGCTGGGCGTCGACCTGTCTCCCATTCAGCCCGACTGGCTGCCG
CCCAACGTTCGCTTCCTCGTTGACGACGTCGAGTCGACTTGGTTGTACCCTCCCAACCACTTCGACTATATCCAT
TCGCGCCATACCGTCATGGCCGTGCGTGACTGGCGCCGACTCTTCCGCCATGCCTACCAGCATCTCAAGCCCGGA
GGCTGGATCGAGCTGCAAGAGATACACCACAAGCCTCGCAGCGCCCGTCCGGACGGCAGACCTCTCTCTCCAGAC
CACGCCGTGGCTCAGTTTTGGGCCCGCGTCAACGAGGGCCTCACGGGGCTCGGCGTCGACCTCGACCGCGCGACC
GGAGGCTACCTGGCCCAGGCCATGCGCGACGAAGGCCTGGTCAACATCACCGAGCGCGTCTTTCACGTGCCAATC
GGAACCTGGCCCAAGAACAAGGTCCTCAAGACGGTCGGCCTCTACTGGCGCACCATTCTGCTCGACGGTCTGCAG
GCCATCGCCCTCGGGCCCCTGACGCGCGGCCTCCATTGGGACCGGCAACAGGTCGAGATGTTTCTCGTCGACGTC
CGCCGCGCCTATCACGACAACTCGGCCCTCATGTACATGCCTCTGCACATCCTCTACGCTCAGAAGCCCGAGTGA
Transcript >Ophcf2|00879
ATGGACATCCGAGAGGTTCAGCGGGATGCTTCCCAGCGGGATACTCTCCAGCGGGATACTCTCCAGCGAGATGCC
GTCCAGCGAGATGCCGTCCAGCGAGATGCCGCTCAACCAGACGGACCCCAACCAGACGACCCCCAGCAGACCCTC
GACCACAGCAAGAAGCTCGACCCCGACGACGCCCGCTTCGCCTCGCCGCTGACGCACCCCAACGGCACTTCTATT
TTCCCCACGCTCTCCGCCTCGGAACAGCATCTCATGGCCCAAGAAGCCCTCGAGCAGGCCCAGGAGGCCATCGTC
CTCGACGAGCAGGTGGTACGCGATGATTCTGACGCTGGTTACAGCAGCGACGGCTTCAGCTCTGCCACTACGTCG
GCCCAGTCCTCGGTACGGGATTACCTCTACGAAAACGGCCGACGATATCACCGCTTCCGCGAGGGCTCCTACAAC
TTTCCCAACGACGACGTCGAGCAAGAGCGCGAAGATATGAAACACGCCATGGTCAAGCTCCTCTGCTCGCAGAAG
CTTCTCTTCGCTCCCATCGGCAACAATCCCCAGCAAATGCTCGATCTCGGCACCGGCACCGGCATATGGGCCATC
GAGGTGGGAGATCAGTACCCGAGCGCTCACGTGCTGGGCGTCGACCTGTCTCCCATTCAGCCCGACTGGCTGCCG
CCCAACGTTCGCTTCCTCGTTGACGACGTCGAGTCGACTTGGTTGTACCCTCCCAACCACTTCGACTATATCCAT
TCGCGCCATACCGTCATGGCCGTGCGTGACTGGCGCCGACTCTTCCGCCATGCCTACCAGCATCTCAAGCCCGGA
GGCTGGATCGAGCTGCAAGAGATACACCACAAGCCTCGCAGCGCCCGTCCGGACGGCAGACCTCTCTCTCCAGAC
CACGCCGTGGCTCAGTTTTGGGCCCGCGTCAACGAGGGCCTCACGGGGCTCGGCGTCGACCTCGACCGCGCGACC
GGAGGCTACCTGGCCCAGGCCATGCGCGACGAAGGCCTGGTCAACATCACCGAGCGCGTCTTTCACGTGCCAATC
GGAACCTGGCCCAAGAACAAGGTCCTCAAGACGGTCGGCCTCTACTGGCGCACCATTCTGCTCGACGGTCTGCAG
GCCATCGCCCTCGGGCCCCTGACGCGCGGCCTCCATTGGGACCGGCAACAGGTCGAGATGTTTCTCGTCGACGTC
CGCCGCGCCTATCACGACAACTCGGCCCTCATGTACATGCCTCTGCACATCCTCTACGCTCAGAAGCCCGAGTGA
Gene >Ophcf2|00879
ATGGACATCCGAGAGGTTCAGCGGGATGCTTCCCAGCGGGATACTCTCCAGCGGGATACTCTCCAGCGAGATGCC
GTCCAGCGAGATGCCGTCCAGCGAGATGCCGCTCAACCAGACGGACCCCAACCAGACGACCCCCAGCAGACCCTC
GACCACAGCAAGAAGCTCGACCCCGACGACGCCCGCTTCGCCTCGCCGCTGACGCACCCCAACGGCACTTCTATT
TTCCCCACGCTCTCCGCCTCGGAACAGCATCTCATGGCCCAAGAAGCCCTCGAGCAGGCCCAGGAGGCCATCGTC
CTCGACGAGCAGGTGGTACGCGATGATTCTGACGCTGGTTACAGCAGCGACGGCTTCAGCTCTGCCACTACGTCG
GCCCAGTCCTCGGTACGGGATTACCTCTACGAAAACGGCCGACGATATCACCGCTTCCGCGAGGGCTCCTACAAC
TTTCCCAACGACGACGTCGAGCAAGAGGTCCGTGTCTTCTTCCTCCTCGCCTTTCTCTCTCCTCTATCCGCGGCT
GATAGCCAGGAAGCGCGAAGATATGAAACACGCCATGGTCAAGCTCCTCTGCTCGCAGAAGCTTCTCTTCGCTCC
CATCGGCAACAATCCCCAGCAAATGCTCGATCTCGGCACCGGCACCGGCATATGGGCCATCGAGGTGGGAGATCA
GTACCCGAGCGCTCACGTGCTGGGCGTCGACCTGTCTCCCATTCAGCCCGACTGGCTGCCGCCCAACGTTCGCTT
CCTCGTTGACGACGTCGAGTCGACTTGGTTGTACCCTCCCAACCACTTCGACTATATCCATTCGCGCCATACCGT
CATGGCCGTGCGTGACTGGCGCCGACTCTTCCGCCATGCCTACCAGTAGGTCTGTCCAGAGAACGAGAGCGAGAG
GAGAGAGGCAGATGGAGCAGACAAACAAGGCCTCGAGAAAACTGACACGTCCATCTTTTCCGCCCAGGCATCTCA
AGCCCGGAGGCTGGATCGAGCTGCAAGAGATACACCACAAGCCTCGCAGCGCCCGTCCGGACGGCAGACCTCTCT
CTCCAGACCACGCCGTGGCTCAGTTTTGGGCCCGCGTCAACGAGGGCCTCACGGGGCTCGGCGTCGACCTCGACC
GCGCGACCGGAGGCTACCTGGCCCAGGCCATGCGCGACGAAGGCCTGGTCAACATCACCGAGCGCGTCTTTCACG
TGCCAATCGGAACCTGGCCCAAGAACAAGGTCCTCAAGACGGTCGGCCTCTACTGGCGCACCATTCTGCTCGACG
GTCTGCAGGCCATCGCCCTCGGGCCCCTGACGCGCGGCCTCCATTGGGACCGGCAACAGGTCGAGATGTTTCTCG
TCGACGTCCGCCGCGCCTATCACGACAACTCGGCCCTCATGTACATGCCTCTGCACATCCTCTACGCTCAGAAGC
CCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail