Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00876
Gene name
Locationscaffold_01:3351599..3353616
Strand-
Gene length (bp)2017
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-31 57 465
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 7.8E-12 99 486

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 85 107 22
3 119 141 22
4 175 197 22
5 204 226 22
6 276 298 22
7 319 341 22
8 356 378 22
9 385 405 20
10 420 442 22
11 455 477 22
12 519 541 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00876
MTNEEAISLSYPNPSFSQMACLDLDQSSRGRKSHDMEKRYGSKPIDGVRQVVVIICLLIGLLFSSLDTSIVSTSL
VTISHELSDFANAPWIVLAYLLTYMGFSVCISKLSDIYGRRNMLLLSWTLFMGFSLACASAKSMMMLIWFRALQG
IGASGLYSLTQIGLVEMGPSHRPSLIGAMIGATLAVAFVSGPLLGGVISQLSDWRWIFYINIPCGLVTFMAIASF
WPQEEVAHLLSRKGLSRVDFIGSAALVCSSGCLVYAIQQGGSQSSAWGSPEVIATFVLSGISCVVFVGWEVFLDT
RRFHNVEPIFPMRLMGRRVYVAGLALTLLTGFPYISLCIIIPERFQIVNGEKALMAGIRILPLLGTCAVGSFLGG
ALSSKRNNTSYTLVGASCLQLLGVGLMTTMNGLQASSAAQYGYQAIFGLGVGLSFSAATIMTNMFAAESSVRASA
QGAVAQARVLGGCIGLSVCTVLFNLTINRQLGGTLTKPQLDMLHRSPLTGLSLPEGLKRLVKAVYVGAFGQQIQV
MGLVCAVMVVVSLFSLERYPTPLSAGAAADKDEVSSSRRGSDSGTEIHTITSTRQTV*
Coding >Ophcf2|00876
ATGACCAACGAGGAAGCAATTTCCCTCTCCTATCCCAACCCATCCTTCAGTCAGATGGCCTGTCTCGACCTGGAC
CAGAGCAGCCGAGGGCGCAAGAGCCATGACATGGAGAAGCGATACGGGTCCAAGCCCATCGATGGCGTCCGCCAG
GTTGTCGTCATCATCTGCCTTCTCATCGGGCTCTTGTTCTCCAGCCTTGACACCTCCATAGTTTCCACGTCCCTG
GTGACGATATCACATGAGCTCAGCGACTTTGCCAATGCCCCCTGGATCGTCCTGGCCTACCTCTTGACGTACATG
GGCTTTTCGGTCTGCATCTCCAAGCTCAGCGACATTTATGGCAGGCGAAACATGCTGCTGCTGTCTTGGACGCTC
TTCATGGGCTTTTCCCTGGCGTGTGCATCGGCCAAGAGTATGATGATGCTCATCTGGTTCCGCGCTCTCCAGGGC
ATCGGCGCCTCCGGCCTGTACTCGTTGACGCAGATCGGGCTCGTCGAGATGGGCCCTAGCCACCGTCCCAGCCTC
ATAGGTGCCATGATAGGGGCCACGCTCGCCGTTGCCTTTGTGTCGGGCCCGCTGTTGGGTGGTGTCATCTCGCAG
CTATCGGACTGGCGATGGATCTTCTACATCAATATTCCCTGTGGATTGGTGACGTTCATGGCCATCGCCAGCTTT
TGGCCGCAGGAAGAGGTCGCTCATCTGCTCTCGCGAAAGGGGCTGTCGCGCGTCGACTTCATTGGCAGCGCGGCC
CTCGTCTGCAGCTCGGGCTGTCTCGTCTACGCCATCCAGCAGGGCGGCTCGCAATCATCGGCTTGGGGAAGCCCA
GAGGTGATAGCGACCTTTGTGCTGTCGGGCATCAGCTGTGTCGTCTTTGTCGGCTGGGAGGTGTTTCTCGACACG
AGACGCTTCCACAACGTCGAGCCCATCTTCCCCATGCGCCTGATGGGCCGACGGGTCTATGTCGCCGGCCTGGCG
CTCACCCTTCTCACGGGCTTTCCCTACATCAGCCTCTGCATCATCATCCCGGAGCGCTTCCAGATCGTCAACGGC
GAAAAGGCGCTGATGGCAGGCATCCGAATCCTTCCACTCTTGGGCACCTGCGCCGTGGGCTCGTTCCTCGGCGGC
GCGCTGTCGAGCAAACGCAACAACACGTCGTACACGCTCGTGGGCGCCTCGTGCCTTCAGCTGCTGGGCGTCGGG
CTCATGACAACCATGAACGGCCTTCAAGCGAGCTCGGCCGCCCAATACGGCTACCAGGCCATCTTCGGACTCGGC
GTCGGCCTCTCCTTTTCGGCCGCCACCATCATGACAAACATGTTTGCGGCCGAATCGAGCGTGAGGGCGTCGGCA
CAGGGGGCCGTTGCACAAGCCCGGGTTCTGGGCGGCTGTATCGGGCTCTCCGTCTGCACCGTCCTGTTCAACCTG
ACCATCAACCGGCAGCTGGGCGGGACTCTGACGAAGCCCCAGCTCGACATGCTGCACCGCTCGCCGCTGACGGGC
CTCAGTCTTCCGGAGGGGCTCAAGAGACTGGTCAAGGCCGTCTACGTGGGCGCCTTTGGGCAGCAGATCCAAGTC
ATGGGCCTCGTGTGTGCTGTCATGGTGGTGGTGTCGCTCTTTAGCCTCGAGAGGTATCCGACGCCACTCTCAGCC
GGAGCGGCGGCCGACAAGGACGAGGTGTCGTCGTCTCGCCGGGGAAGCGATTCCGGGACGGAAATTCACACGATA
ACGAGCACGCGGCAGACGGTGTAA
Transcript >Ophcf2|00876
ATGACCAACGAGGAAGCAATTTCCCTCTCCTATCCCAACCCATCCTTCAGTCAGATGGCCTGTCTCGACCTGGAC
CAGAGCAGCCGAGGGCGCAAGAGCCATGACATGGAGAAGCGATACGGGTCCAAGCCCATCGATGGCGTCCGCCAG
GTTGTCGTCATCATCTGCCTTCTCATCGGGCTCTTGTTCTCCAGCCTTGACACCTCCATAGTTTCCACGTCCCTG
GTGACGATATCACATGAGCTCAGCGACTTTGCCAATGCCCCCTGGATCGTCCTGGCCTACCTCTTGACGTACATG
GGCTTTTCGGTCTGCATCTCCAAGCTCAGCGACATTTATGGCAGGCGAAACATGCTGCTGCTGTCTTGGACGCTC
TTCATGGGCTTTTCCCTGGCGTGTGCATCGGCCAAGAGTATGATGATGCTCATCTGGTTCCGCGCTCTCCAGGGC
ATCGGCGCCTCCGGCCTGTACTCGTTGACGCAGATCGGGCTCGTCGAGATGGGCCCTAGCCACCGTCCCAGCCTC
ATAGGTGCCATGATAGGGGCCACGCTCGCCGTTGCCTTTGTGTCGGGCCCGCTGTTGGGTGGTGTCATCTCGCAG
CTATCGGACTGGCGATGGATCTTCTACATCAATATTCCCTGTGGATTGGTGACGTTCATGGCCATCGCCAGCTTT
TGGCCGCAGGAAGAGGTCGCTCATCTGCTCTCGCGAAAGGGGCTGTCGCGCGTCGACTTCATTGGCAGCGCGGCC
CTCGTCTGCAGCTCGGGCTGTCTCGTCTACGCCATCCAGCAGGGCGGCTCGCAATCATCGGCTTGGGGAAGCCCA
GAGGTGATAGCGACCTTTGTGCTGTCGGGCATCAGCTGTGTCGTCTTTGTCGGCTGGGAGGTGTTTCTCGACACG
AGACGCTTCCACAACGTCGAGCCCATCTTCCCCATGCGCCTGATGGGCCGACGGGTCTATGTCGCCGGCCTGGCG
CTCACCCTTCTCACGGGCTTTCCCTACATCAGCCTCTGCATCATCATCCCGGAGCGCTTCCAGATCGTCAACGGC
GAAAAGGCGCTGATGGCAGGCATCCGAATCCTTCCACTCTTGGGCACCTGCGCCGTGGGCTCGTTCCTCGGCGGC
GCGCTGTCGAGCAAACGCAACAACACGTCGTACACGCTCGTGGGCGCCTCGTGCCTTCAGCTGCTGGGCGTCGGG
CTCATGACAACCATGAACGGCCTTCAAGCGAGCTCGGCCGCCCAATACGGCTACCAGGCCATCTTCGGACTCGGC
GTCGGCCTCTCCTTTTCGGCCGCCACCATCATGACAAACATGTTTGCGGCCGAATCGAGCGTGAGGGCGTCGGCA
CAGGGGGCCGTTGCACAAGCCCGGGTTCTGGGCGGCTGTATCGGGCTCTCCGTCTGCACCGTCCTGTTCAACCTG
ACCATCAACCGGCAGCTGGGCGGGACTCTGACGAAGCCCCAGCTCGACATGCTGCACCGCTCGCCGCTGACGGGC
CTCAGTCTTCCGGAGGGGCTCAAGAGACTGGTCAAGGCCGTCTACGTGGGCGCCTTTGGGCAGCAGATCCAAGTC
ATGGGCCTCGTGTGTGCTGTCATGGTGGTGGTGTCGCTCTTTAGCCTCGAGAGGTATCCGACGCCACTCTCAGCC
GGAGCGGCGGCCGACAAGGACGAGGTGTCGTCGTCTCGCCGGGGAAGCGATTCCGGGACGGAAATTCACACGATA
ACGAGCACGCGGCAGACGGTGTAA
Gene >Ophcf2|00876
ATGACCAACGAGGAAGCAATTTCCCTCTCCTATCCCAACCCATCCTTCAGTCAGATGGCCTGTCTCGACCTGGAC
CAGAGCAGCCGAGGGCGCAAGAGCCATGACATGGAGAAGCGATACGGGTCCAAGCCCATCGATGGCGTCCGCCAG
GTTGTCGTCATCATCTGGTAAGGACTCAATCCCGCCTCCATGAATCGGCGACGCTGACCCTTGCACATGCAGCCT
TCTCATCGGGCTCTTGTTCTCCAGCCTTGACACCTCCATAGTTTCCACGTCCCTGGTGACGATATCACATGAGCT
CAGCGACTTTGCCAATGCCCCCTGGATCGTCCTGGCCTACCTCTTGACGTACATGGGTCAGTTGGCTGTGAAAAC
GAGCGAATGTTGGTTGTCTGATGCCGTCCTCTAGGCTTTTCGGTCTGCATCTCCAAGCTCAGCGACATTTATGGC
AGGCGAAACATGCTGCTGCTGTCTTGGACGCTCTTCATGGGCTTTTCCCTGGCGTGTGCATCGGCCAAGAGTATG
ATGATGCTGTAATTGTCGCCGCCACCCTTCGGATACTGCCTGTCGGCTGACCATGGCCAGCATCTGGTTCCGCGC
TCTCCAGGGCATCGGCGCCTCCGGCCTGTACTCGTTGACGCAGATCGGGCTCGTCGAGATGGGCCCTAGCCACCG
TCCCAGCCTCATAGGTGCCATGATAGGGGCCACGCTCGCCGTTGCCTTTGTGTCGGGCCCGCTGTTGGGTGGTGT
CATCTCGCAGCTATCGGACTGGCGATGGATCTTCTACATCAAGTGAGTCGAGTCAGGTAGGACATGACAGAGACG
GACTGACAGGCGGCATTCAGTATTCCCTGTGGATTGGTGACGTTCATGGCCATCGCCAGCTTTTGGCCGCAGGAA
GAGGTCGCTCATCTGCTCTCGCGAAAGGGGCTGTCGCGCGTCGACTTCATTGGCAGCGCGGCCCTCGTCTGCAGC
TCGGGCTGTCTCGTCTACGCCATCCAGCAGGGCGGCTCGCAATCATCGGCTTGGGGAAGCCCAGAGGTGATAGCG
ACCTTTGTGCTGTCGGGCATCAGCTGTGTCGTCTTTGTCGGCTGGGAGGTGTTTCTCGACACGAGACGCTTCCAC
AACGTCGAGCCCATCTTCCCCATGCGCCTGATGGGCCGACGGGTCTATGTCGCCGGCCTGGCGTACGTCTATCTG
TTGAGAGAGGGCGAGACGGATAGGCTGCTGACTCTTTTCAAGGCTCACCCTTCTCACGGGCTTTCCCTACATCAG
CCTCTGCATCATCATCCCGGAGCGCTTCCAGATCGTCAACGGCGAAAAGGCGCTGATGGCAGGCATCCGAATCCT
TCCACTCTTGGGCACCTGCGCCGTGGGCTCGTTCCTCGGCGGCGCGCTGTCGAGCAAACGCAACAACACGTCGTA
CACGCTCGTGGGCGCCTCGTGCCTTCAGCTGCTGGGCGTCGGGCTCATGACAACCATGAACGGCCTTCAAGCGAG
CTCGGCCGCCCAATACGGCTACCAGGCCATCTTCGGACTCGGCGTCGGCCTCTCCTTTTCGGCCGCCACCATCAT
GACAAACATGTTTGCGGCCGAATCGAGCGTGAGGGCGTCGGCACAGGGGGCCGTTGCACAAGCCCGGGTTCTGGG
CGGCTGTATCGGGCTCTCCGTCTGCACCGTCCTGTTCAACCTGACCATCAACCGGCAGCTGGGCGGGACTCTGAC
GAAGCCCCAGCTCGACATGCTGCACCGCTCGCCGCTGACGGGCCTCAGTCTTCCGGAGGGGCTCAAGAGACTGGT
CAAGGCCGTCTACGTGGGCGCCTTTGGGCAGCAGATCCAAGTCATGGGCCTCGTGTGTGCTGTCATGGTGGTGGT
GTCGCTCTTTAGCCTCGAGAGGTATCCGACGCCACTCTCAGCCGGAGCGGCGGCCGACAAGGACGAGGTGTCGTC
GTCTCGCCGGGGAAGCGATTCCGGGACGGAAATTCACACGATAACGAGCACGCGGCAGACGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail