Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00872
Gene name
Locationscaffold_01:3346099..3347459
Strand+
Gene length (bp)1360
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03878 YIF1 YIF1 1.3E-98 73 321

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0005575 cellular_component No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0031090 organelle membrane No
GO:0048193 Golgi vesicle transport No
GO:0016020 membrane No
GO:0046907 intracellular transport No
GO:0016192 vesicle-mediated transport No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 163 182 19
2 192 214 22
3 227 245 18
4 255 274 19
5 308 325 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00872
MQRAPYGQSPPLHHPVPQHVSTVPQLRSPPPPPGSAQSQQQSYGGTPFQQQQQQQQQGASAGNMFGGYGQFMNDP
AAQVAAQFGQTAFKHGQEYVEQNLGRYVQISALKRYFNVSNSYVVNKLFLVLFPWRHKPWSRKQAVGANGQEGWY
LPPREDINSPDMYIPVMALVTFILLSTLIAGLRGKFQPELLGYTATTGMVVVIVEIVALKLGCFMLSISSQSQLL
DLIAYSGYKFVGIIVTIAVAEISNGGKGTGGWAGWAVFFYTFLANSLFLMRSLKYVLLPETSGNTGGPMQTDSRA
KRNQRTQFLFFYSYIVQFLFMREAGRFGDAAALNPRANRRWRCRAEKELAWIMEARVVVKAEAVEVEARRLGGKQ
KGNL*
Coding >Ophcf2|00872
ATGCAGCGGGCGCCTTACGGGCAGTCGCCCCCGTTGCACCACCCCGTGCCCCAGCACGTCTCGACGGTCCCCCAG
CTACGGTCACCACCTCCGCCGCCAGGCTCTGCCCAGTCACAACAGCAGAGTTATGGCGGGACGCCTTTCCAGCAG
CAGCAGCAGCAGCAGCAGCAAGGCGCGTCGGCGGGTAATATGTTTGGCGGCTATGGCCAGTTCATGAACGACCCG
GCTGCTCAGGTAGCTGCCCAATTTGGCCAGACGGCTTTCAAGCATGGCCAGGAGTATGTCGAGCAGAATCTTGGT
CGTTATGTCCAAATCTCGGCGCTCAAGCGATACTTCAACGTCTCCAACTCTTACGTCGTCAACAAGCTCTTCCTC
GTCCTCTTTCCCTGGCGGCACAAGCCCTGGTCGCGCAAGCAAGCCGTCGGCGCCAACGGTCAGGAGGGATGGTAT
CTGCCTCCTCGAGAAGACATCAACAGCCCGGACATGTACATCCCAGTCATGGCCCTCGTCACCTTCATTCTCCTC
TCGACGCTCATTGCCGGCTTGAGAGGCAAGTTTCAGCCGGAGCTACTAGGGTACACGGCGACGACGGGTATGGTG
GTGGTTATTGTCGAGATTGTCGCCCTCAAGCTGGGCTGCTTCATGTTGAGCATTTCCAGTCAGTCTCAGCTCCTC
GATCTGATTGCCTATTCCGGGTACAAGTTTGTCGGCATAATCGTCACCATCGCCGTGGCCGAGATCTCCAATGGC
GGAAAGGGCACTGGCGGTTGGGCTGGCTGGGCCGTCTTCTTCTACACCTTTTTGGCCAACTCTCTGTTCCTGATG
CGATCCCTCAAATATGTTTTGCTGCCGGAGACGTCTGGAAACACCGGCGGCCCTATGCAGACCGACTCTCGAGCG
AAGCGCAACCAGAGGACGCAGTTTCTCTTCTTCTACTCATACATTGTTCAGTTTCTCTTCATGCGCGAAGCAGGT
CGGTTCGGCGACGCCGCTGCTCTCAACCCCCGAGCCAACAGACGATGGCGTTGCCGCGCCGAGAAGGAACTAGCC
TGGATCATGGAGGCCCGGGTCGTGGTCAAAGCAGAGGCAGTCGAAGTGGAAGCGAGGCGTCTTGGTGGAAAGCAG
AAGGGGAACCTGTAG
Transcript >Ophcf2|00872
ATGCAGCGGGCGCCTTACGGGCAGTCGCCCCCGTTGCACCACCCCGTGCCCCAGCACGTCTCGACGGTCCCCCAG
CTACGGTCACCACCTCCGCCGCCAGGCTCTGCCCAGTCACAACAGCAGAGTTATGGCGGGACGCCTTTCCAGCAG
CAGCAGCAGCAGCAGCAGCAAGGCGCGTCGGCGGGTAATATGTTTGGCGGCTATGGCCAGTTCATGAACGACCCG
GCTGCTCAGGTAGCTGCCCAATTTGGCCAGACGGCTTTCAAGCATGGCCAGGAGTATGTCGAGCAGAATCTTGGT
CGTTATGTCCAAATCTCGGCGCTCAAGCGATACTTCAACGTCTCCAACTCTTACGTCGTCAACAAGCTCTTCCTC
GTCCTCTTTCCCTGGCGGCACAAGCCCTGGTCGCGCAAGCAAGCCGTCGGCGCCAACGGTCAGGAGGGATGGTAT
CTGCCTCCTCGAGAAGACATCAACAGCCCGGACATGTACATCCCAGTCATGGCCCTCGTCACCTTCATTCTCCTC
TCGACGCTCATTGCCGGCTTGAGAGGCAAGTTTCAGCCGGAGCTACTAGGGTACACGGCGACGACGGGTATGGTG
GTGGTTATTGTCGAGATTGTCGCCCTCAAGCTGGGCTGCTTCATGTTGAGCATTTCCAGTCAGTCTCAGCTCCTC
GATCTGATTGCCTATTCCGGGTACAAGTTTGTCGGCATAATCGTCACCATCGCCGTGGCCGAGATCTCCAATGGC
GGAAAGGGCACTGGCGGTTGGGCTGGCTGGGCCGTCTTCTTCTACACCTTTTTGGCCAACTCTCTGTTCCTGATG
CGATCCCTCAAATATGTTTTGCTGCCGGAGACGTCTGGAAACACCGGCGGCCCTATGCAGACCGACTCTCGAGCG
AAGCGCAACCAGAGGACGCAGTTTCTCTTCTTCTACTCATACATTGTTCAGTTTCTCTTCATGCGCGAAGCAGGT
CGGTTCGGCGACGCCGCTGCTCTCAACCCCCGAGCCAACAGACGATGGCGTTGCCGCGCCGAGAAGGAACTAGCC
TGGATCATGGAGGCCCGGGTCGTGGTCAAAGCAGAGGCAGTCGAAGTGGAAGCGAGGCGTCTTGGTGGAAAGCAG
AAGGGGAACCTGTAG
Gene >Ophcf2|00872
ATGCAGCGGGCGCCTTACGGGCAGTCGCCCCCGTTGCACCACCCCGTGCCCCAGCACGTCTCGACGGTCCCCCAG
CTACGGTCACCACCTCCGCCGCCAGGCTCTGCCCAGTCACAACAGCAGAGTTATGGCGGGACGCCTTTCCAGCAG
CAGCAGCAGCAGCAGCAGCAAGGCGCGTCGGCGGGTAATATGTTTGGCGGCTATGGCCAGTTCATGAACGACCCG
GCTGCTCAGGTAGCTGCCCAATTTGGCCAGACGGCTTTCAAGCATGGCCAGGAGTATGTCGAGCAGAATGTACCA
TTGCCCTTGTGTCCCGTGTGATAGGTTTGATAGCTGAAGGTTTCCGGCAGCTTGGTCGTTATGTCCAAATCTCGG
CGCTCAAGCGATACTTCAACGTCTCCAACTCTTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTTCCCTGGCGGC
ACAAGCCCTGGTCGCGCAAGCAAGCCGTCGGCGCCAACGGTCAGGAGGGATGGTATCTGCCTCCTCGAGAAGACA
TCAACAGCCCGGACATGTACATCCCAGGTTTGTTGTCTTTGCGGTTTGTTGGCGACGTCGCTCGCAGGCTGACGT
CTCAGTCATGGCCCTCGTCACCTTCATTCTCCTCTCGACGCTCATTGCCGGCTTGAGAGGCAAGTTTCAGCCGGA
GCTACTAGGGTACACGGCGACGACGGGTATGGTGGTGGTTATTGTCGAGATTGTCGCCCTCAAGCTGGGCTGCTT
CATGTTGAGCATTTCCAGTCAGTCTCAGCTCCTCGATCTGATTGCCTATTCCGGGTACAAGTTTGTCGGCATAAT
CGTCACCATCGCCGTGGCCGAGATCTCCAATGGCGGAAAGGGCACTGGCGGTTGGGCTGGCTGGGCCGTCTTCTT
CTACACCTTTTTGGCCAACTCTCTGTTCCTGGTAGGGTCATGACAGTTGAAAGTTTTCGGTGACTGGAGCTGACT
CGATCTCTAGATGCGATCCCTCAAATATGTTTTGCTGCCGGAGACGTCTGGAAACACCGGCGGCCCTATGCAGAC
CGACTCTCGAGCGAAGCGCAACCAGAGGACGCAGTTTCTCTTCTTCTACTCATACATTGTTCAGTTTCTCTTCAT
GTGGGTTCTCACTAGAGCCTAAATGAAGCCGCATGTTACGACAAGGATCAAGGCAAGGCGCGAAGCAGGTCGGTT
CGGCGACGCCGCTGCTCTCAACCCCCGAGCCAACAGACGATGGCGTTGCCGCGCCGAGAAGGAACTAGCCTGGAT
CATGGAGGCCCGGGTCGTGGTCAAAGCAGAGGCAGTCGAAGTGGAAGCGAGGCGTCTTGGTGGAAAGCAGAAGGG
GAACCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail