Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00859
Gene name
Locationscaffold_01:3304064..3305868
Strand+
Gene length (bp)1804
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04258 Peptidase_A22B Signal peptide peptidase 6.0E-33 82 365
PF04258 Peptidase_A22B Signal peptide peptidase 8.8E-19 431 496

GO

GO Term Description Terminal node
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0070001 aspartic-type peptidase activity No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0004175 endopeptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 88 106 18
3 119 141 22
4 244 266 22
5 271 288 17
6 298 320 22
7 340 359 19
8 438 460 22
9 467 484 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00859
MSSDPTVIPDPVEPAPTSALAYLRERHFLLLELKLLAGAVGIIYVGAHAALRRPPSASPVKRSRKAGKKAADEDD
DAPISQGLELSDAITFPLTAAAMLIGLYYLIQWLQDPALLNKMLRTYLAAMSLASLTTFFAHSLDLASSFVFPRW
WRGRDGPLRRVEQKARVVLVCDDVGNAVVDNGSAKAVVAADSDAAAPRQGPLPGFLGLLTGSARARRLAWSARGV
LNKSWVARLFVRGVGDTEMSISSNYAMSLLLSSITAVVYFCTTSPLLSNLLGYSLCYGSFLIISPTDLLTGSLVL
VGLFLYDIIMVFYTPYMLAVATQLDVPIKLTFQTAARKTMLGLGDIVLPGMVIGWALRLDLYMHYLRKIKYEPAE
LKVVQQDATSGGIVTRTETKHKEVKARYVNVKGRWGDVFWTRGLFSARQAPAELAAASFRKTYFYASVVGYTLGL
VVTVAMLLFFQKGQPALLYLVPGVLGALVGTAWARGEMSDVWRYSEDGSLDKVDVVVELDAEGRVVKALGKAEDG
VLDTTGNNDKNKDGDKKDTHHKDGSSEGNKGRQVALLSLEAASDDDLDGEEDS*
Coding >Ophcf2|00859
ATGTCGTCCGACCCGACGGTGATCCCGGACCCCGTCGAGCCCGCACCGACCTCGGCCCTGGCTTACCTCCGGGAA
AGACATTTTCTGCTGCTGGAGCTGAAGCTGCTCGCCGGCGCCGTCGGCATCATCTACGTCGGTGCCCATGCTGCT
CTCCGTCGGCCTCCTTCGGCATCTCCTGTCAAGCGGAGCAGGAAAGCCGGGAAGAAAGCGGCCGACGAGGACGAC
GATGCGCCCATCTCGCAGGGCCTGGAGTTGTCTGATGCCATCACGTTCCCGCTCACGGCGGCGGCCATGCTCATC
GGACTGTACTACCTGATACAGTGGCTTCAGGATCCGGCCCTGCTCAATAAGATGCTGAGGACCTACCTGGCGGCC
ATGTCTCTGGCCAGCTTGACGACATTTTTCGCCCACTCCCTCGACCTGGCCTCATCGTTTGTCTTTCCGAGGTGG
TGGCGAGGCCGCGATGGGCCACTGAGGAGAGTCGAGCAGAAGGCTCGGGTTGTGCTCGTCTGCGACGATGTGGGC
AACGCCGTCGTCGACAATGGCTCGGCCAAGGCTGTCGTTGCTGCGGACTCGGACGCGGCGGCGCCTAGACAGGGA
CCTCTTCCGGGCTTTTTGGGCTTGCTTACGGGTTCAGCTAGGGCGAGGCGGCTCGCTTGGAGCGCTCGGGGTGTC
TTGAACAAGTCCTGGGTCGCCCGACTCTTTGTTCGTGGAGTCGGTGATACCGAGATGAGCATCAGCTCCAACTAC
GCCATGAGCTTGCTGCTCTCATCAATCACGGCCGTCGTTTACTTTTGCACCACGTCGCCTCTGTTGTCCAATTTG
CTGGGATACAGTCTGTGCTACGGCTCGTTTCTGATAATCTCACCAACGGACTTGTTGACGGGTTCTCTCGTCCTC
GTCGGGCTCTTTCTTTACGACATCATCATGGTGTTTTACACGCCGTACATGTTGGCCGTCGCCACCCAGTTGGAC
GTTCCCATCAAGCTCACCTTCCAGACGGCCGCTAGGAAGACCATGCTGGGTCTGGGCGACATCGTCCTTCCTGGC
ATGGTCATCGGCTGGGCGCTACGCCTCGACCTCTACATGCACTACCTCCGGAAGATCAAATACGAGCCCGCGGAG
CTCAAAGTGGTGCAGCAGGACGCGACGTCGGGGGGGATTGTCACGCGGACCGAGACGAAGCACAAGGAGGTCAAG
GCGCGGTACGTCAATGTCAAGGGCCGGTGGGGGGACGTCTTCTGGACGCGAGGCCTGTTCTCCGCGCGACAGGCT
CCGGCCGAACTGGCGGCTGCGAGCTTCCGCAAGACGTACTTTTACGCCTCCGTCGTCGGCTACACGCTGGGGCTG
GTCGTCACCGTGGCGATGCTGCTCTTCTTCCAGAAGGGCCAGCCGGCGCTGCTGTACCTTGTTCCCGGGGTCCTC
GGCGCTCTGGTTGGTACGGCTTGGGCTCGGGGCGAGATGAGCGACGTGTGGAGGTACAGCGAGGACGGCAGTCTC
GATAAGGTCGACGTGGTCGTTGAACTTGACGCTGAGGGTCGCGTTGTCAAGGCGCTGGGCAAGGCCGAGGACGGT
GTGTTGGACACGACGGGCAACAATGACAAGAACAAAGACGGTGATAAGAAGGACACCCACCACAAGGACGGCAGC
TCGGAAGGCAACAAAGGCCGACAGGTGGCGCTGCTGTCGCTCGAAGCAGCCTCGGACGACGACTTGGACGGAGAG
GAGGATAGCTAG
Transcript >Ophcf2|00859
ATGTCGTCCGACCCGACGGTGATCCCGGACCCCGTCGAGCCCGCACCGACCTCGGCCCTGGCTTACCTCCGGGAA
AGACATTTTCTGCTGCTGGAGCTGAAGCTGCTCGCCGGCGCCGTCGGCATCATCTACGTCGGTGCCCATGCTGCT
CTCCGTCGGCCTCCTTCGGCATCTCCTGTCAAGCGGAGCAGGAAAGCCGGGAAGAAAGCGGCCGACGAGGACGAC
GATGCGCCCATCTCGCAGGGCCTGGAGTTGTCTGATGCCATCACGTTCCCGCTCACGGCGGCGGCCATGCTCATC
GGACTGTACTACCTGATACAGTGGCTTCAGGATCCGGCCCTGCTCAATAAGATGCTGAGGACCTACCTGGCGGCC
ATGTCTCTGGCCAGCTTGACGACATTTTTCGCCCACTCCCTCGACCTGGCCTCATCGTTTGTCTTTCCGAGGTGG
TGGCGAGGCCGCGATGGGCCACTGAGGAGAGTCGAGCAGAAGGCTCGGGTTGTGCTCGTCTGCGACGATGTGGGC
AACGCCGTCGTCGACAATGGCTCGGCCAAGGCTGTCGTTGCTGCGGACTCGGACGCGGCGGCGCCTAGACAGGGA
CCTCTTCCGGGCTTTTTGGGCTTGCTTACGGGTTCAGCTAGGGCGAGGCGGCTCGCTTGGAGCGCTCGGGGTGTC
TTGAACAAGTCCTGGGTCGCCCGACTCTTTGTTCGTGGAGTCGGTGATACCGAGATGAGCATCAGCTCCAACTAC
GCCATGAGCTTGCTGCTCTCATCAATCACGGCCGTCGTTTACTTTTGCACCACGTCGCCTCTGTTGTCCAATTTG
CTGGGATACAGTCTGTGCTACGGCTCGTTTCTGATAATCTCACCAACGGACTTGTTGACGGGTTCTCTCGTCCTC
GTCGGGCTCTTTCTTTACGACATCATCATGGTGTTTTACACGCCGTACATGTTGGCCGTCGCCACCCAGTTGGAC
GTTCCCATCAAGCTCACCTTCCAGACGGCCGCTAGGAAGACCATGCTGGGTCTGGGCGACATCGTCCTTCCTGGC
ATGGTCATCGGCTGGGCGCTACGCCTCGACCTCTACATGCACTACCTCCGGAAGATCAAATACGAGCCCGCGGAG
CTCAAAGTGGTGCAGCAGGACGCGACGTCGGGGGGGATTGTCACGCGGACCGAGACGAAGCACAAGGAGGTCAAG
GCGCGGTACGTCAATGTCAAGGGCCGGTGGGGGGACGTCTTCTGGACGCGAGGCCTGTTCTCCGCGCGACAGGCT
CCGGCCGAACTGGCGGCTGCGAGCTTCCGCAAGACGTACTTTTACGCCTCCGTCGTCGGCTACACGCTGGGGCTG
GTCGTCACCGTGGCGATGCTGCTCTTCTTCCAGAAGGGCCAGCCGGCGCTGCTGTACCTTGTTCCCGGGGTCCTC
GGCGCTCTGGTTGGTACGGCTTGGGCTCGGGGCGAGATGAGCGACGTGTGGAGGTACAGCGAGGACGGCAGTCTC
GATAAGGTCGACGTGGTCGTTGAACTTGACGCTGAGGGTCGCGTTGTCAAGGCGCTGGGCAAGGCCGAGGACGGT
GTGTTGGACACGACGGGCAACAATGACAAGAACAAAGACGGTGATAAGAAGGACACCCACCACAAGGACGGCAGC
TCGGAAGGCAACAAAGGCCGACAGGTGGCGCTGCTGTCGCTCGAAGCAGCCTCGGACGACGACTTGGACGGAGAG
GAGGATAGCTAG
Gene >Ophcf2|00859
ATGTCGTCCGACCCGACGGTGATCCCGGACCCCGTCGAGCCCGCACCGACCTCGGCCCTGGCTTACCTCCGGGAA
AGACATTTTCTGCTGCTGGAGCTGAAGCTGCTCGCCGGCGCCGTCGGCATCATCTACGTCGGTGCCCATGCTGCT
CTCCGTCGGCCTCCTTCGGCATCTCCTGTCAAGCGGAGCAGGAAAGCCGGGAAGAAAGCGGCCGACGAGGACGAC
GATGCGCCCATCTCGCAGGGCCTGGAGTTGTCTGATGCCATCACGTTCCCGCTCACGGCGGCGGCCATGCTCATC
GGACTGTACTACCTGATACAGTGGCTTCAGGATCCGGCCCTGCTCAATAAGATGCTGAGGACCTACCTGGCGGCC
ATGTCTCTGGCCAGCTTGACGACATTTTTCGCCCACTCCCTCGACCTGGCCTCATCGTTTGTCTTTCCGAGGTGG
TGGCGAGGCCGCGATGGGCCACTGAGGAGAGTCGAGCAGAAGGCTCGGGTTGTGCTCGTCTGCGACGATGTGGGC
AACGCCGTCGTCGACAATGGCTCGGCCAAGGCTGTCGTTGCTGCGGACTCGGACGCGGCGGCGCCTAGACAGGGA
CCTCTTCCGGGCTTTTTGGGCTTGCTTACGGGTTCAGCTAGGGCGAGGCGGCTCGCTTGGAGCGCTCGGGGTGTC
TTGAACAAGTCCTGGGTCGCCCGACTCTTTGTTCGTGGAGTCGGTGATACCGAGATGAGCATCAGCTCCAACTAC
GCCATGAGCTTGCTGCTCTCATCAATCACGGCCGTCGTTTACTTTTGCACCACGTCGCCTCTGTTGTCCAATTTG
CTGGGATACAGTCTGTGCTACGGCTCGTTTCTGATAATCTCACCAACGGACTTGTTGACGGGTTCTCTCGTCCTC
GTCGGGCTCTTTCTTTACGACATCATCATGGTGTTTTACACGTGAGCGCCTCACGGAACCCTTTTTGCCCGCCCG
TCTCACTCATCAGCTAAATAAACGTCGTCTCAGGCCGTACATGTTGGCCGTCGCCACCCAGTTGGACGTTCCCAT
CAAGCTCACCTTCCAGACGGCCGCTAGGAAGACCATGCTGGGTCTGGGCGACATCGTCCTTCCTGGCATGGTCAT
CGGCTGGGCGCTACGCCTCGACCTCTACATGCACTACCTCCGGAAGATCAAATACGAGCCCGCGGAGCTCAAAGT
GGTGCAGCAGGACGCGACGTCGGGGGGGATTGTCACGCGGACCGAGACGAAGCACAAGGAGGTCAAGGCGCGGTA
CGTCAATGTCAAGGGCCGGTGGGGGGACGTCTTCTGGACGCGAGGCCTGTTCTCCGCGCGACAGGCTCCGGCCGA
ACTGGCGGCTGCGAGCTTCCGCAAGACGTACTTTTACGCCTCCGTCGTCGGCTACACGCTGGGGCTGGTCGTCAC
CGTGGCGATGCTGCTCTTCTTCCAGAAGGGCCAGCCGGCGCTGCTGTACCTTGTTCCCGGGGTCCTCGGCGCTCT
GGTTGGTACGGCTTGGGCTCGGGGCGAGATGAGCGACGTGTGGAGGTACAGCGAGGACGGCAGTCTCGATAAGGT
CGACGTGGTCGTTGAACTTGACGCTGAGGGTCGCGTTGTCAAGGCGCTGGGCAAGGCCGAGGACGGTGTGTTGGA
CACGACGGGCAACAATGACAAGAACAAAGACGGTGATAAGAAGGACACCCACCACAAGGACGGCAGCTCGGAAGG
CAACAAAGGCCGACAGGTGGCGCTGCTGTCGCTCGAAGCAGCCTCGGACGACGACTTGGACGGAGAGGAGGATAG
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail