Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00850
Gene name
Locationscaffold_01:3283943..3284670
Strand+
Gene length (bp)727
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.3E-10 21 85

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Cell membrane 0.0765 0.0664 0.9048 0.5238 0.0873 0.0029 0.1779 0.1074 0.1092 0.0044

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999721

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup977
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6629
Ophiocordyceps australis map64 (Brazil) OphauB2|3088
Ophiocordyceps australis map64 (Brazil) OphauB2|6718
Ophiocordyceps camponoti-floridani Ophcf2|00850 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4489
Ophiocordyceps kimflemingae Ophio5|612
Ophiocordyceps subramaniannii Hirsu2|7886

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00850
MKTTFAVAAVAGLVAAQDFAGQPQCAVGCIRDALPKVGCKVEDVACACKPETQARLLSEVAPCVIGHCSPQEAQQ
AQGAARAACAKIGSQTEGAASSSQAAASGSNSGTDSGSASQTSSMTVLTTTGTPVTATAVVTGSASTDTASDSGD
DNSTATGDDQSQSQSGSATDSGASDQATSTGGGSSGSSTSSRNASPSATGAAAGGPSTGAFAAIMALVLAL*
Coding >Ophcf2|00850
ATGAAGACTACCTTTGCTGTCGCTGCTGTTGCTGGCCTTGTTGCCGCTCAGGACTTTGCTGGCCAGCCTCAATGC
GCTGTCGGCTGCATCCGTGATGCTCTTCCCAAGGTGGGCTGCAAGGTCGAGGACGTGGCCTGCGCCTGCAAGCCC
GAGACTCAAGCCCGGCTCCTGAGCGAGGTTGCCCCTTGTGTCATCGGCCACTGCTCTCCTCAGGAGGCTCAGCAG
GCCCAGGGCGCCGCGAGGGCTGCCTGTGCCAAGATCGGCTCCCAGACGGAGGGGGCCGCCTCTTCCTCCCAGGCC
GCCGCCTCGGGCTCCAACTCGGGCACCGACTCCGGCTCGGCCTCTCAGACGAGCTCCATGACCGTCTTGACGACG
ACGGGCACTCCCGTTACCGCCACCGCCGTTGTCACTGGCTCGGCCTCCACCGACACGGCATCCGACTCGGGTGAT
GACAACTCTACGGCCACTGGCGACGACCAGTCTCAGTCTCAGTCCGGCAGCGCCACCGACTCCGGCGCCTCGGAT
CAGGCTACCAGCACTGGCGGCGGCTCGTCTGGATCATCCACCAGCTCCCGCAACGCCTCGCCCAGCGCGACGGGT
GCTGCTGCTGGCGGTCCTTCTACGGGCGCCTTTGCTGCCATCATGGCTCTCGTCTTGGCCTTGTAA
Transcript >Ophcf2|00850
ATGAAGACTACCTTTGCTGTCGCTGCTGTTGCTGGCCTTGTTGCCGCTCAGGACTTTGCTGGCCAGCCTCAATGC
GCTGTCGGCTGCATCCGTGATGCTCTTCCCAAGGTGGGCTGCAAGGTCGAGGACGTGGCCTGCGCCTGCAAGCCC
GAGACTCAAGCCCGGCTCCTGAGCGAGGTTGCCCCTTGTGTCATCGGCCACTGCTCTCCTCAGGAGGCTCAGCAG
GCCCAGGGCGCCGCGAGGGCTGCCTGTGCCAAGATCGGCTCCCAGACGGAGGGGGCCGCCTCTTCCTCCCAGGCC
GCCGCCTCGGGCTCCAACTCGGGCACCGACTCCGGCTCGGCCTCTCAGACGAGCTCCATGACCGTCTTGACGACG
ACGGGCACTCCCGTTACCGCCACCGCCGTTGTCACTGGCTCGGCCTCCACCGACACGGCATCCGACTCGGGTGAT
GACAACTCTACGGCCACTGGCGACGACCAGTCTCAGTCTCAGTCCGGCAGCGCCACCGACTCCGGCGCCTCGGAT
CAGGCTACCAGCACTGGCGGCGGCTCGTCTGGATCATCCACCAGCTCCCGCAACGCCTCGCCCAGCGCGACGGGT
GCTGCTGCTGGCGGTCCTTCTACGGGCGCCTTTGCTGCCATCATGGCTCTCGTCTTGGCCTTGTAA
Gene >Ophcf2|00850
ATGAAGACTACCTTTGCTGTCGCTGCTGTTGCTGGCCTTGTTGCCGCTCAGGACTTTGCTGGCCAGCCTCAATGC
GCTGTATGGCTTGCTTGCTTCCTCTGTCGAACTGGATATGTTGATTAACATTGCTCTCGTCCAGGTCGGCTGCAT
CCGTGATGCTCTTCCCAAGGTGGGCTGCAAGGTCGAGGACGTGGCCTGCGCCTGCAAGCCCGAGACTCAAGCCCG
GCTCCTGAGCGAGGTTGCCCCTTGTGTCATCGGCCACTGCTCTCCTCAGGAGGCTCAGCAGGCCCAGGGCGCCGC
GAGGGCTGCCTGTGCCAAGATCGGCTCCCAGACGGAGGGGGCCGCCTCTTCCTCCCAGGCCGCCGCCTCGGGCTC
CAACTCGGGCACCGACTCCGGCTCGGCCTCTCAGACGAGCTCCATGACCGTCTTGACGACGACGGGCACTCCCGT
TACCGCCACCGCCGTTGTCACTGGCTCGGCCTCCACCGACACGGCATCCGACTCGGGTGATGACAACTCTACGGC
CACTGGCGACGACCAGTCTCAGTCTCAGTCCGGCAGCGCCACCGACTCCGGCGCCTCGGATCAGGCTACCAGCAC
TGGCGGCGGCTCGTCTGGATCATCCACCAGCTCCCGCAACGCCTCGCCCAGCGCGACGGGTGCTGCTGCTGGCGG
TCCTTCTACGGGCGCCTTTGCTGCCATCATGGCTCTCGTCTTGGCCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail