Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00846
Gene name
Locationscaffold_01:3270510..3271980
Strand-
Gene length (bp)1470
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2025 0.0788 0.9618 0.121 0.0618 0.0419 0.2366 0.1483 0.2696 0.0024

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.999723

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2549
Ophiocordyceps australis map64 (Brazil) OphauB2|8150
Ophiocordyceps camponoti-floridani Ophcf2|00846 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1758
Ophiocordyceps kimflemingae Ophio5|607
Ophiocordyceps subramaniannii Hirsu2|1750
Ophiocordyceps subramaniannii Hirsu2|3274
Ophiocordyceps subramaniannii Hirsu2|4091

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00846
MAAMKSLSWSLAAVLLNSPLLIKAEKVEARPLGKDVTIKGNAVSWISPGGFEDGFQCRGSRILCISDDKTMAACC
EEKNKLKGSLESGFYCCAEGHDLAGSKEVGYSCCPTGQQFDGKVCKLVCTNGKVLVDGRCACPIGLEETAEGGCI
KPKCTSGLMTGKCYMFKGESGRRLAYKNKQYSEAIPSKDTIPGKFQLCRDEKCTPNLPINPSQEVHIRDVHGSPP
DSADANQWLNNASGGNHMGKTPKYAESGNFTITKWPCGKYCLSGVQTGLGPACPSEDPSITFYRTLSEACVEFEL
VEVPCKIRDSKNNCIWKGSKNQCCGKEVCTAADDDDTPEPSSQQPSSSPSSTSSSSTSIEAAPPSETKPSKAQLC
PDKHGSTLEANGIGFRVLCGWYYSAKDKLEELKNVRDPLTCHAKCAADSKCQGANFNWASFFCTHQIDWAAEMKD
GGNVTGCVTFHPTKPRPV*
Coding >Ophcf2|00846
ATGGCGGCCATGAAGAGCCTCTCCTGGAGCCTTGCGGCCGTCCTCCTCAACTCGCCCTTGCTCATCAAGGCGGAA
AAGGTGGAAGCCAGACCGCTGGGCAAGGACGTGACAATCAAGGGCAACGCCGTGTCGTGGATCAGTCCCGGAGGC
TTCGAAGACGGCTTCCAGTGCCGCGGCTCGCGTATCCTCTGTATCAGCGACGACAAGACCATGGCCGCCTGCTGC
GAGGAGAAGAACAAGCTCAAGGGGTCGCTCGAGTCGGGCTTTTACTGCTGCGCCGAAGGGCACGACCTGGCCGGC
TCTAAGGAGGTCGGCTACAGCTGCTGCCCAACTGGCCAGCAGTTTGACGGCAAGGTCTGCAAGCTCGTCTGTACT
AATGGAAAGGTCCTCGTCGACGGCAGGTGTGCCTGTCCCATAGGCCTTGAGGAGACGGCCGAAGGCGGCTGCATC
AAGCCCAAGTGCACGTCTGGGTTGATGACTGGCAAATGCTACATGTTCAAGGGCGAGTCCGGACGTCGTCTGGCC
TACAAGAACAAGCAGTACTCCGAGGCAATCCCCAGCAAGGACACCATCCCGGGCAAGTTCCAGCTCTGCCGAGAC
GAAAAGTGCACGCCAAACCTGCCCATCAATCCGAGCCAGGAGGTCCATATCCGAGACGTCCACGGCTCCCCCCCA
GACTCAGCCGACGCCAACCAGTGGCTCAACAACGCCAGCGGAGGCAACCACATGGGGAAGACGCCCAAGTACGCC
GAATCTGGCAACTTTACCATCACCAAGTGGCCCTGCGGTAAGTATTGTCTCAGCGGCGTGCAGACGGGCCTCGGA
CCGGCTTGCCCCAGCGAGGACCCGTCCATCACCTTCTATCGCACTCTCAGCGAGGCCTGTGTCGAGTTCGAGCTG
GTCGAGGTGCCTTGCAAGATCCGGGACAGCAAGAATAACTGCATCTGGAAGGGCAGCAAGAACCAGTGCTGCGGT
AAGGAGGTGTGTACGGCAGCGGACGACGATGACACCCCTGAGCCCTCGTCCCAGCAGCCCTCATCGTCGCCCTCA
TCTACGTCATCGTCTTCGACGTCGATCGAGGCCGCCCCTCCTTCGGAGACGAAGCCGTCCAAGGCCCAGCTCTGC
CCGGATAAGCACGGGTCGACGCTCGAGGCCAACGGCATCGGCTTCCGCGTCCTCTGCGGCTGGTACTACTCAGCC
AAGGACAAGCTCGAGGAGTTGAAGAACGTGCGGGATCCTCTGACGTGTCATGCCAAGTGTGCGGCCGACAGCAAG
TGCCAGGGCGCCAACTTTAACTGGGCCAGCTTCTTCTGTACCCATCAGATTGACTGGGCGGCTGAGATGAAGGAC
GGAGGCAACGTCACGGGTTGTGTGACTTTCCATCCGACGAAGCCGCGGCCTGTTTAA
Transcript >Ophcf2|00846
ATGGCGGCCATGAAGAGCCTCTCCTGGAGCCTTGCGGCCGTCCTCCTCAACTCGCCCTTGCTCATCAAGGCGGAA
AAGGTGGAAGCCAGACCGCTGGGCAAGGACGTGACAATCAAGGGCAACGCCGTGTCGTGGATCAGTCCCGGAGGC
TTCGAAGACGGCTTCCAGTGCCGCGGCTCGCGTATCCTCTGTATCAGCGACGACAAGACCATGGCCGCCTGCTGC
GAGGAGAAGAACAAGCTCAAGGGGTCGCTCGAGTCGGGCTTTTACTGCTGCGCCGAAGGGCACGACCTGGCCGGC
TCTAAGGAGGTCGGCTACAGCTGCTGCCCAACTGGCCAGCAGTTTGACGGCAAGGTCTGCAAGCTCGTCTGTACT
AATGGAAAGGTCCTCGTCGACGGCAGGTGTGCCTGTCCCATAGGCCTTGAGGAGACGGCCGAAGGCGGCTGCATC
AAGCCCAAGTGCACGTCTGGGTTGATGACTGGCAAATGCTACATGTTCAAGGGCGAGTCCGGACGTCGTCTGGCC
TACAAGAACAAGCAGTACTCCGAGGCAATCCCCAGCAAGGACACCATCCCGGGCAAGTTCCAGCTCTGCCGAGAC
GAAAAGTGCACGCCAAACCTGCCCATCAATCCGAGCCAGGAGGTCCATATCCGAGACGTCCACGGCTCCCCCCCA
GACTCAGCCGACGCCAACCAGTGGCTCAACAACGCCAGCGGAGGCAACCACATGGGGAAGACGCCCAAGTACGCC
GAATCTGGCAACTTTACCATCACCAAGTGGCCCTGCGGTAAGTATTGTCTCAGCGGCGTGCAGACGGGCCTCGGA
CCGGCTTGCCCCAGCGAGGACCCGTCCATCACCTTCTATCGCACTCTCAGCGAGGCCTGTGTCGAGTTCGAGCTG
GTCGAGGTGCCTTGCAAGATCCGGGACAGCAAGAATAACTGCATCTGGAAGGGCAGCAAGAACCAGTGCTGCGGT
AAGGAGGTGTGTACGGCAGCGGACGACGATGACACCCCTGAGCCCTCGTCCCAGCAGCCCTCATCGTCGCCCTCA
TCTACGTCATCGTCTTCGACGTCGATCGAGGCCGCCCCTCCTTCGGAGACGAAGCCGTCCAAGGCCCAGCTCTGC
CCGGATAAGCACGGGTCGACGCTCGAGGCCAACGGCATCGGCTTCCGCGTCCTCTGCGGCTGGTACTACTCAGCC
AAGGACAAGCTCGAGGAGTTGAAGAACGTGCGGGATCCTCTGACGTGTCATGCCAAGTGTGCGGCCGACAGCAAG
TGCCAGGGCGCCAACTTTAACTGGGCCAGCTTCTTCTGTACCCATCAGATTGACTGGGCGGCTGAGATGAAGGAC
GGAGGCAACGTCACGGGTTGTGTGACTTTCCATCCGACGAAGCCGCGGCCTGTTTAA
Gene >Ophcf2|00846
ATGGCGGCCATGAAGAGCCTCTCCTGGAGCCTTGCGGCCGTCCTCCTCAACTCGCCCTTGCTCATCAAGGCGGAA
AAGGTGGAAGCCAGACCGCTGGGCAAGGACGTGACAATCAAGGGCAACGCCGTGTCGTGGATCAGTCCCGGAGGC
TTCGAAGACGGCTTCCAGTGCCGCGGCTCGCGTATCCTCTGTATCAGCGACGACAAGACCATGGCCGCCTGCTGC
GAGGAGAAGAACAAGCTCAAGGGGTCGCTCGAGTCGGGCTTTTACTGCTGCGCCGAAGGGCACGACCTGGCCGGC
TCTAAGGAGGTCGGCTACAGCTGCTGCCCAACTGGCCAGCAGTTTGACGGCAAGGTCTGCAAGCTCGTCTGTACT
AATGGAAAGGTCCTCGTCGACGGCAGGTGTGCCTGTCCCATAGGCCTTGAGGAGACGGCCGAAGGCGGCTGCATC
AAGCCCAAGTGCACGTCTGGGTTGATGACTGGTAAGTGAGTCCTTGTTTCCGTACGACATGTAAACGACATGTAT
CAACTCACCCTCCCATCAGGCAAATGCTACATGTTCAAGGGCGAGTCCGGACGTCGTCTGGCCTACAAGAACAAG
CAGTACTCCGAGGCAATCCCCAGCAAGGACACCATCCCGGGCAAGTTCCAGCTCTGCCGAGACGAAAAGTGCACG
CCAAACCTGCCCATCAATCCGAGCCAGGAGGTCCATATCCGAGACGTCCACGGCTCCCCCCCAGACTCAGCCGAC
GCCAACCAGTGGCTCAACAACGCCAGCGGAGGCAACCACATGGGGAAGACGCCCAAGTACGCCGAATCTGGCAAC
TTTACCATCACCAAGTGGCCCTGCGGTAAGTATTGTCTCAGCGGCGTGCAGACGGGCCTCGGACCGGCTTGCCCC
AGCGAGGACCCGTCCATCACCTTCTATCGCACTCTCAGCGAGGCCTGTGTCGAGTTCGAGCTGGTCGAGGTGCCT
TGCAAGATCCGGGACAGCAAGAATAACTGCATCTGGAAGGGCAGCAAGAACCAGTGCTGCGGTAAGGAGGTGTGT
ACGGCAGCGGACGACGATGACACCCCTGAGCCCTCGTCCCAGCAGCCCTCATCGTCGCCCTCATCTACGTCATCG
TCTTCGACGTCGATCGAGGCCGCCCCTCCTTCGGAGACGAAGCCGTCCAAGGCCCAGCTCTGCCCGGATAAGCAC
GGGTCGACGCTCGAGGCCAACGGCATCGGCTTCCGCGTCCTCTGCGGCTGGTACTACTCAGCCAAGGACAAGCTC
GAGGAGTTGAAGAACGTGCGGGATCCTCTGACGTGTCATGCCAAGTGTGCGGCCGACAGCAAGTGCCAGGGCGCC
AACTTTAACTGGGCCAGCTTCTTCTGTACCCATCAGATTGACTGGGCGGCTGAGATGAAGGACGGAGGCAACGTC
ACGGGTTGTGTGACTTTCCATCCGACGAAGCCGCGGCCTGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail