Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00844
Gene name
Locationscaffold_01:3263050..3264340
Strand-
Gene length (bp)1290
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase 8.0E-95 15 315

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.9072 0.4224 0.0987 0.2286 0.3578 0.0985 0.0274 0.0809 0.0828 0.0141

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1298
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4733
Ophiocordyceps australis map64 (Brazil) OphauB2|3112
Ophiocordyceps camponoti-floridani Ophcf2|00844 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1760
Ophiocordyceps kimflemingae Ophio5|4722
Ophiocordyceps subramaniannii Hirsu2|10604

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00844
MSNSLEQLKASGTVVVSDSGDFASIGKYKPQDATTNPSLILAASKKAEYAKLMDVAVAYGKSQGGSLDSQVDHAL
DRLLVEFGKEILKIIPGKVSTEVDARFSFDTKSSVGKALHIIELYKEQGIPKERVLIKVASTWEGIKAAEILQRE
HGINCNLTLMFSLVQAIAAAEAQAYLISPFVGRILDWFKASTKKEYAKEEDPGVASVKKIFEYYKKYGYKTIVMG
ASFRNTGEITELAGCDYLTISPNLLEDLMNSSEAVPKKLDAATAIKSDMERRSYINDESLFRFDFNEDQMAVEKL
REGISKFAADAVALKDILKAKLSS*
Coding >Ophcf2|00844
ATGTCAAACTCTCTGGAACAGCTCAAAGCCAGCGGCACGGTCGTCGTGTCCGATTCTGGTGATTTTGCCTCCATC
GGCAAGTACAAGCCGCAGGATGCCACAACCAACCCGTCTCTCATCCTGGCCGCGTCCAAAAAGGCCGAATATGCC
AAGTTGATGGATGTGGCCGTCGCATATGGAAAGTCTCAAGGCGGCTCCCTCGACTCTCAGGTCGACCATGCGCTT
GACCGTCTGCTGGTTGAGTTTGGCAAGGAGATTCTGAAAATCATCCCCGGAAAGGTCTCGACCGAGGTCGACGCC
CGCTTTTCCTTTGACACCAAGTCTTCGGTCGGGAAAGCGCTGCACATCATCGAGCTCTACAAGGAGCAAGGTATT
CCCAAGGAGCGCGTCCTCATCAAGGTCGCCTCCACTTGGGAGGGCATCAAGGCCGCCGAGATCCTTCAGCGCGAG
CACGGCATCAACTGCAACCTGACGCTCATGTTCTCCCTCGTGCAGGCCATCGCCGCTGCCGAGGCCCAGGCCTAC
CTCATCTCTCCCTTTGTCGGCCGCATCCTCGACTGGTTCAAGGCCAGCACCAAGAAGGAGTACGCCAAGGAGGAG
GATCCCGGGGTGGCATCGGTCAAGAAGATCTTTGAGTACTACAAAAAGTACGGCTACAAGACGATTGTCATGGGT
GCCTCGTTCCGCAACACGGGCGAGATTACGGAGCTGGCCGGTTGCGACTACCTCACCATCTCGCCCAACCTGCTC
GAGGATCTCATGAACTCTTCCGAGGCCGTGCCCAAGAAGCTCGACGCGGCGACGGCGATCAAGAGCGACATGGAG
CGCCGTTCGTACATCAATGACGAGTCTCTGTTCCGCTTCGACTTCAACGAGGATCAGATGGCGGTCGAGAAGCTG
CGCGAAGGCATCAGCAAGTTTGCCGCCGACGCCGTCGCGCTCAAGGACATTCTCAAGGCGAAGCTGTCGTCTTGA
Transcript >Ophcf2|00844
ATGTCAAACTCTCTGGAACAGCTCAAAGCCAGCGGCACGGTCGTCGTGTCCGATTCTGGTGATTTTGCCTCCATC
GGCAAGTACAAGCCGCAGGATGCCACAACCAACCCGTCTCTCATCCTGGCCGCGTCCAAAAAGGCCGAATATGCC
AAGTTGATGGATGTGGCCGTCGCATATGGAAAGTCTCAAGGCGGCTCCCTCGACTCTCAGGTCGACCATGCGCTT
GACCGTCTGCTGGTTGAGTTTGGCAAGGAGATTCTGAAAATCATCCCCGGAAAGGTCTCGACCGAGGTCGACGCC
CGCTTTTCCTTTGACACCAAGTCTTCGGTCGGGAAAGCGCTGCACATCATCGAGCTCTACAAGGAGCAAGGTATT
CCCAAGGAGCGCGTCCTCATCAAGGTCGCCTCCACTTGGGAGGGCATCAAGGCCGCCGAGATCCTTCAGCGCGAG
CACGGCATCAACTGCAACCTGACGCTCATGTTCTCCCTCGTGCAGGCCATCGCCGCTGCCGAGGCCCAGGCCTAC
CTCATCTCTCCCTTTGTCGGCCGCATCCTCGACTGGTTCAAGGCCAGCACCAAGAAGGAGTACGCCAAGGAGGAG
GATCCCGGGGTGGCATCGGTCAAGAAGATCTTTGAGTACTACAAAAAGTACGGCTACAAGACGATTGTCATGGGT
GCCTCGTTCCGCAACACGGGCGAGATTACGGAGCTGGCCGGTTGCGACTACCTCACCATCTCGCCCAACCTGCTC
GAGGATCTCATGAACTCTTCCGAGGCCGTGCCCAAGAAGCTCGACGCGGCGACGGCGATCAAGAGCGACATGGAG
CGCCGTTCGTACATCAATGACGAGTCTCTGTTCCGCTTCGACTTCAACGAGGATCAGATGGCGGTCGAGAAGCTG
CGCGAAGGCATCAGCAAGTTTGCCGCCGACGCCGTCGCGCTCAAGGACATTCTCAAGGCGAAGCTGTCGTCTTGA
Gene >Ophcf2|00844
ATGTCAAACTCTCTGGAACAGCTCAAAGCCAGCGGCACGGTACGTTCCCATCGATATTACCCCTCAAGGTATCGC
CGAGGCTGAGCCATGGCCTTCGTCCCATCTTATCCGGTCGCTCAATAGGTCGTCGTGTCCGATTCTGGTGAGTCT
CAACTGACGTCTTCCTCCTCGCTCTGTCGCCATTCATCGCTAATCACGTTCGTCTTCAGGTGATTTTGCCTGTTA
GTCTCGTCGAGTCCCCCCGATCCTCTCAGACAATAATAGCTCACGCCTGGGATAGCCATCGGCAAGTACAAGCCG
CAGGATGCCACAACCAACCCGTCTCTCATCCTGGCCGCGTCCAAAAAGGCCGAATATGCCAAGTTGATGGATGTG
GCCGTCGCATATGGAAAGTCTCAAGGCGGCTCCCTCGACTCTCAGGTCGACCATGCGCTTGACCGTCTGCTGGTT
GAGTTTGGCAAGGAGATTCTGAAAATCATCCCCGGAAAGGTCTCGACCGAGGTCGACGCCCGCTTTTCCTTTGAC
ACCAAGTCTTCGGTCGGGAAAGCGCTGCACATCATCGAGGCGAGTCCGCCGGCTTCCCCATCTCCGCCTTCTCCG
TTAACCCTCAAGTAGCTCTACAAGGAGCAAGGTATTCCCAAGGAGCGCGTCCTCATCAAGGTCGCCTCCACTTGG
GAGGGCATCAAGGCCGCCGAGATCCTTCAGCGCGAGCACGGCATCAACTGCAACCTGACGCTCATGTTCTCCCTC
GTGCAGGCCATCGCCGCTGCCGAGGCCCAGGCCTACCTCATCTCTCCCTTTGTCGGCCGCATCCTCGACTGGTTC
AAGGCCAGCACCAAGAAGGAGTACGCCAAGGAGGAGGATCCCGGGGTGGCATCGGTCAAGAAGATCTTTGAGTAC
TACAAAAAGTACGGCTACAAGACGATTGTCATGGGTGCCTCGTTCCGCAACACGGGCGAGATTACGGAGCTGGCC
GGTTGCGACTACCTCACCATCTCGGTAGGTTCCTACTCCCCATGTTCCTCTGGCTAGCTGTTCACTGATTCGCGA
TAGCCCAACCTGCTCGAGGATCTCATGAACTCTTCCGAGGCCGTGCCCAAGAAGCTCGACGCGGCGACGGCGATC
AAGAGCGACATGGAGCGCCGTTCGTACATCAATGACGAGTCTCTGTTCCGCTTCGACTTCAACGAGGATCAGATG
GCGGTCGAGAAGCTGCGCGAAGGCATCAGCAAGTTTGCCGCCGACGCCGTCGCGCTCAAGGACATTCTCAAGGCG
AAGCTGTCGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail