Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00834
Gene name
Locationscaffold_01:3234879..3236108
Strand+
Gene length (bp)1229
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00645 zf-PARP Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region 3.7E-22 7 99

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1523 0.9024 0.3331 0.0404 0.1221 0.2159 0.0105 0.003 0.0405 0.0025

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2536
Ophiocordyceps australis map64 (Brazil) OphauB2|3120
Ophiocordyceps camponoti-floridani Ophcf2|00834 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5520
Ophiocordyceps kimflemingae Ophio5|7122
Ophiocordyceps subramaniannii Hirsu2|7774

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00834
MPQYRIEVSPNNRAVCKDSICKGNQEKITKGDIRFGSWVEIKEHGSWSWKHWGCVSGAQLVAVQELCESGDGKYD
FEAIDGYDELGAHPDIQEKIRRCVEQGHIDPEDFKGDPEKNKPGEKGIHLTQKQKAAKEQSANDESGEESDEEEA
VPKKKAAKRGRKKAEAEDEDEPIVKKAKTSKAAPKPAKAARGKASVKKVEDKEETEVDASDEEAPKAKKSQKLKA
ADGPKSRAKADADGAETMRRSSRRTKPVLPPKPVADSDDEDDELAAETDDEPPAKGKRGGKAKAGAKPRRGRARR
D*
Coding >Ophcf2|00834
ATGCCTCAGTATCGCATCGAGGTTTCGCCCAATAACCGGGCCGTTTGCAAAGATAGCATCTGCAAAGGAAACCAG
GAGAAAATCACAAAGGGCGACATCCGCTTCGGTTCCTGGGTCGAGATCAAGGAACATGGCAGCTGGTCCTGGAAG
CACTGGGGATGCGTTTCTGGTGCCCAGCTAGTAGCCGTCCAGGAGCTCTGCGAATCGGGGGATGGAAAGTATGAC
TTTGAGGCCATTGACGGTTATGACGAATTGGGTGCCCATCCTGATATCCAGGAGAAGATTCGTCGCTGCGTTGAG
CAGGGCCACATTGATCCCGAAGACTTTAAAGGCGATCCTGAAAAGAACAAGCCCGGTGAGAAGGGAATTCACTTG
ACTCAGAAGCAAAAGGCTGCCAAGGAGCAGTCTGCCAATGATGAATCCGGCGAGGAATCTGATGAGGAAGAGGCC
GTCCCCAAGAAAAAGGCAGCCAAGCGCGGACGCAAGAAGGCCGAGGCTGAAGATGAAGATGAACCCATCGTCAAA
AAGGCCAAGACGTCCAAGGCGGCTCCGAAGCCCGCCAAGGCTGCTCGTGGCAAGGCGTCGGTCAAAAAGGTCGAG
GATAAGGAAGAAACCGAAGTCGACGCCAGCGATGAGGAGGCGCCCAAGGCCAAGAAGTCGCAGAAACTCAAGGCG
GCCGACGGACCCAAGTCTCGTGCCAAAGCAGACGCGGACGGCGCCGAGACGATGCGGAGGAGCAGCCGCAGAACC
AAACCCGTCTTGCCTCCCAAGCCGGTGGCCGATTCGGATGACGAAGACGATGAGCTGGCAGCCGAGACGGACGAC
GAACCGCCGGCCAAGGGCAAGCGAGGTGGAAAGGCAAAGGCCGGGGCTAAGCCTCGTCGTGGACGGGCTCGCAGG
GACTGA
Transcript >Ophcf2|00834
ATGCCTCAGTATCGCATCGAGGTTTCGCCCAATAACCGGGCCGTTTGCAAAGATAGCATCTGCAAAGGAAACCAG
GAGAAAATCACAAAGGGCGACATCCGCTTCGGTTCCTGGGTCGAGATCAAGGAACATGGCAGCTGGTCCTGGAAG
CACTGGGGATGCGTTTCTGGTGCCCAGCTAGTAGCCGTCCAGGAGCTCTGCGAATCGGGGGATGGAAAGTATGAC
TTTGAGGCCATTGACGGTTATGACGAATTGGGTGCCCATCCTGATATCCAGGAGAAGATTCGTCGCTGCGTTGAG
CAGGGCCACATTGATCCCGAAGACTTTAAAGGCGATCCTGAAAAGAACAAGCCCGGTGAGAAGGGAATTCACTTG
ACTCAGAAGCAAAAGGCTGCCAAGGAGCAGTCTGCCAATGATGAATCCGGCGAGGAATCTGATGAGGAAGAGGCC
GTCCCCAAGAAAAAGGCAGCCAAGCGCGGACGCAAGAAGGCCGAGGCTGAAGATGAAGATGAACCCATCGTCAAA
AAGGCCAAGACGTCCAAGGCGGCTCCGAAGCCCGCCAAGGCTGCTCGTGGCAAGGCGTCGGTCAAAAAGGTCGAG
GATAAGGAAGAAACCGAAGTCGACGCCAGCGATGAGGAGGCGCCCAAGGCCAAGAAGTCGCAGAAACTCAAGGCG
GCCGACGGACCCAAGTCTCGTGCCAAAGCAGACGCGGACGGCGCCGAGACGATGCGGAGGAGCAGCCGCAGAACC
AAACCCGTCTTGCCTCCCAAGCCGGTGGCCGATTCGGATGACGAAGACGATGAGCTGGCAGCCGAGACGGACGAC
GAACCGCCGGCCAAGGGCAAGCGAGGTGGAAAGGCAAAGGCCGGGGCTAAGCCTCGTCGTGGACGGGCTCGCAGG
GACTGA
Gene >Ophcf2|00834
ATGCCTCAGTATCGCATCGGTCAGTCTTTCTCCGTTTCCTCGTGGCTTTTCCCTCGTGGCTTTTTCCCTCTTGAC
TGACGATCGGCTGGCAGAGGTTTCGCCCAATAACCGGGCCGTTTGCAAAGATAGCATCTGCAAAGGAAACCAGGA
GAAAATCACAAAGGGCGACATCCGCTTCGGTTCCTGGGTCGAGATCAAGGAACATGGCAGCTGGTCCTGGAAGCA
CTGGTAAGCCTCTCTCATTCTTTATCCTTCTCATGCGTCTCGAGACTGACTTTGCCTCCGCCAGGGGATGCGTTT
CTGGTGCCCAGCTAGTAGCCGTCCAGGAGCTCTGCGAATCGGGGGATGGAAAGTATGACTTTGAGGCCATTGACG
GTTATGACGAATTGGGGTGAGTTTGCTTGGATTTGATTCTCTCCATCAAGACTCATCTAACGACTTGCTAGTGCC
CATCCTGATATCCAGGAGAAGATTCGTCGCTGCGTTGAGCAGGGCCACATTGATCCCGAAGACTTTAAAGGCGTA
TGTATCCATCTCGCCTCGTTTTTTTTTTTTTTTTTTCATCCCCCTTTCTCGTCTCTGACTGTCATCTCTGCAGGA
TCCTGAAAAGAACAAGCCCGGTGAGAAGGGAATTCACTTGACTCAGAAGCAAAAGGCTGCCAAGGAGCAGTCTGC
CAATGATGAATCCGGCGAGGTACGTTGGTTGACCCAGCTCATGTTCTCCCAGCCGTCTTGCTCACCGTCTCACCT
AGGAATCTGATGAGGAAGAGGCCGTCCCCAAGAAAAAGGCAGCCAAGCGCGGACGCAAGAAGGCCGAGGCTGAAG
ATGAAGATGAACCCATCGTCAAAAAGGCCAAGACGTCCAAGGCGGCTCCGAAGCCCGCCAAGGCTGCTCGTGGCA
AGGCGTCGGTCAAAAAGGTCGAGGATAAGGAAGAAACCGAAGTCGACGCCAGCGATGAGGAGGCGCCCAAGGCCA
AGAAGTCGCAGAAACTCAAGGCGGCCGACGGACCCAAGTCTCGTGCCAAAGCAGACGCGGACGGCGCCGAGACGA
TGCGGAGGAGCAGCCGCAGAACCAAACCCGTCTTGCCTCCCAAGCCGGTGGCCGATTCGGATGACGAAGACGATG
AGCTGGCAGCCGAGACGGACGACGAACCGCCGGCCAAGGGCAAGCGAGGTGGAAAGGCAAAGGCCGGGGCTAAGC
CTCGTCGTGGACGGGCTCGCAGGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail